SInCRe - Rv3214

Tuberculist information

Gene name	gpm2
Protein function	Possible phosphoglycerate mutase Gpm2 (phosphoglyceromutase) (PGAM) (BPG-dependent PGAM)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	3591.65
Molecular mass(da)	21948.8
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 203

	  		  	1    MGVRNHRLLLLRHGETAWSTLGRHTGGTEVELTDTGRTQAELAGQLLGELELDDPIVICS   60
			  	61   PRRRTLDTAKLAGLTVNEVTGLLAEWDYGSYEGLTTPQIRESEPDWLVWTHGCPAGESVA  120
			  	121  QVNDRADSAVALALEHMSSRDVLFVSHGHFSRAVITRWVQLPLAEGSRFAMPTASIGICG  180
			  	181  FEHGVRQLAVLGLTGHPQPIAAG

Known structures in the PDB

No Known structures

Number of amino acids : 203

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
His_Phos_1	PF00300	7-154

Mtb Structural Proteome models

Model Number	1
Model name	Rv3214_2a6p_A
Template	2A6P APDB CREDO
Template coverage	4_196
Template Identity(%)	100.0
Model coverage(%)	94.6
Normalized DOPE score	-1.995

Model Number	2
Model name	Rv3214
Template	2A6P APDB CREDO
Template coverage	4_196
Template Identity(%)	100.0
Model coverage(%)	94.6
Normalized DOPE score	-1.724

Structure Models from Chopin

Model Number	1
Profile	3.40.50.1240 Click for model details
zscore	33.25
Residue begin	1
Residue end	203

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3214	Gene name	Confidence Score
Rv3215	entC	0.964
Rv1437	pgk	0.925
Rv1023	eno	0.919
Rv1023	eno	0.919
Rv2205c	Rv2205c	0.918
Rv0728c	serA2	0.911
Rv0728c	serA2	0.911

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3214_2a6p_A	3	1xbb_STI_A_1 PDB CREDO	0.676	0.101	0.643	0.001
Rv3214_2a6p_A	3	1fb7_ROC_A_100 PDB CREDO	0.740	0.054	0.597	0.002
Rv3214_2a6p_A	3	3grv_ADN_A_300 PDB CREDO	0.658	0.117	0.568	0.004
Rv3214_2a6p_A	3	1yi4_ADN_A_306 PDB CREDO	0.624	0.151	0.563	0.004
Rv3214_2a6p_A	1	1ynn_RFP_C_1120 PDB CREDO	0.573	0.213	0.553	0.005
Rv3214_2a6p_A	1	4eyb_0WO_A_303 PDB CREDO	0.550	0.244	0.550	0.005
Rv3214_2a6p_A	1	3lxe_TOR_B_262 PDB CREDO	0.630	0.145	0.544	0.006
Rv3214_2a6p_A	1	3lxe_TOR_A_262 PDB CREDO	0.624	0.151	0.539	0.006
Rv3214_2a6p_A	1	1hwi_115_C_4 PDB CREDO	0.551	0.243	0.532	0.007
Rv3214_2a6p_A	3	2y7j_B49_C_1294 PDB CREDO	0.553	0.240	0.526	0.007
Rv3214_2a6p_A	1	3k2h_LYA_B_514 PDB CREDO	0.525	0.280	0.525	0.007
Rv3214_2a6p_A	3	2y7j_B49_D_1294 PDB CREDO	0.663	0.112	0.522	0.008
Rv3214_2a6p_A	1	2a69_RPT_M_8002 PDB CREDO	0.578	0.206	0.521	0.008
Rv3214_2a6p_A	1	1cil_ETS_A_263 PDB CREDO	0.558	0.233	0.521	0.008
Rv3214_2a6p_A	1	4eyb_0WO_B_301 PDB CREDO	0.560	0.231	0.521	0.008
Rv3214_2a6p_A	1	2a68_RBT_C_8001 PDB CREDO	0.531	0.271	0.513	0.009
Rv3214_2a6p_A	3	1qhy_CLM_A_999 PDB CREDO	0.538	0.260	0.512	0.009
Rv3214_2a6p_A	3	3ug2_IRE_A_1 PDB CREDO	0.538	0.260	0.512	0.009
Rv3214_2a6p_A	3	1uay_ADN_B_1002 PDB CREDO	0.669	0.107	0.510	0.009
Rv3214_2a6p_A	1	1hwi_115_A_2 PDB CREDO	0.583	0.200	0.508	0.010
Rv3214_2a6p_A	1	1a4l_DCF_D_1853 PDB CREDO	0.521	0.286	0.503	0.011
Rv3214_2a6p_A	1	1a4l_DCF_A_353 PDB CREDO	0.519	0.288	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
glycerolPubChem	0.954	92.0938
phosphoglyceratePubChem	0.919	186.057
3-phosphoglyceratePubChem	0.918	186.057
protiumPubChem	0.9	2.01576
C04171PubChem	0.9	156.136
deuteriumPubChem	0.9	2.01588
DL-serinePubChem	0.9	105.093
reduced nicotinamide adenine dinucleotidePubChem	0.9	665.441
H(+)PubChem	0.9	2.01588
adenosine triphosphatePubChem	0.9	507.181
sulfatePubChem	0.9	96.0626
2-phospho-D-glyceratePubChem	0.9	186.057
EB4PubChem	0.9	669.547
hydron sulfatePubChem	0.9	196.157
AR-1G6178PubChem	0.9	156.136
2,3-dihydroxybenzoic acidPubChem	0.9	154.12
NAD+PubChem	0.9	663.425
N-[7,11-bis[(2,3-dihydroxybenzoyl)amino]-2,6,10-trioxo-1,5,9-trioxacyclododec-3-yl]-2,3-dihydroxybenPubChem	0.9	669.547
adenosine monophosphatePubChem	0.9	347.221
pyrophosphatePubChem	0.9	177.975
dihydronicotinamide formycin dinucleotidePubChem	0.9	665.441
L-serinePubChem	0.9	105.093
selenomethioninePubChem	0.703	196.106