SInCRe - Rv3009c

Tuberculist information

Gene name	gatB
Protein function	Probable glutamyl-tRNA(GLN) amidotransferase (subunit B) GatB (Glu-ADT subunit B)
Functional category(tuberculist)	information pathways
Gene location(kb)	3367.26
Molecular mass(da)	54632.9
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 509

	  		  	1    MTVAAGAAKAAGAELLDYDEVVARFQPVLGLEVHVELSTATKMFCGCTTTFGGEPNTQVC   60
			  	61   PVCLGLPGSLPVLNRAAVESAIRIGLALNCEIVPWCRFARKNYFYPDMPKNYQISQYDEP  120
			  	121  IAINGYLDAPLEDGTTWRVEIERAHMEEDTGKLTHIGSETGRIHGATGSLIDYNRAGVPL  180
			  	181  IEIVTKPIVGAGARAPQIARSYVTALRDLLRALDVSDVRMDQGSMRCDANVSLKPAGTTE  240
			  	241  FGTRTETKNVNSLKSVEVAVRYEMQRQGAILASGGRITQETRHFHEAGYTSAGRTKETAE  300
			  	301  DYRYFPEPDLEPVAPSRELVERLRQTIPELPWLSRRRIQQEWGVSDEVMRDLVNAGAVEL  360
			  	361  VAATVEHGASSEAARAWWGNFLAQKANEAGIGLDELAITPAQVAAVVALVDEGKLSNSLA  420
			  	421  RQVVEGVLAGEGEPEQVMTARGLALVRDDSLTQAAVDEALAANPDVADKIRGGKVAAAGA  480
			  	481  IVGAVMKATRGQADAARVRELVLEACGQG

Known structures in the PDB

No Known structures

Number of amino acids : 509

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
GatB_N	PF02934	26-323
GatB_Yqey	PF02637	359-506

Mtb Structural Proteome models

Model Number	1
Model name	Rv3009c
Template	2F2A BPDB CREDO
Template coverage	4_411
Template Identity(%)	44.4
Model coverage(%)	82.3
Normalized DOPE score	-0.141

Model Number	2
Model name	Rv3009c.1
Template	1ZQ1 CPDB CREDO
Template coverage	5_511
Template Identity(%)	20.6
Model coverage(%)	93.1
Normalized DOPE score	0.852

Structure Models from Chopin

Model Number	1
Profile	a.182.1.2, d.128.1.5 Click for model details
zscore	72.8
Residue begin	26
Residue end	445

Model Number	2
Profile	d.128.1.5 Click for model details
zscore	65.72
Residue begin	26
Residue end	328

Model Number	3
Profile	a.182.1.2 Click for model details
zscore	18.22
Residue begin	329
Residue end	434

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3009c	Gene name	Confidence Score
Rv3011c	gatA	0.999
Rv3012c	gatC	0.999
Rv2572c	aspS	0.97
Rv2572c	aspS	0.97
Rv2572c	aspS	0.97
Rv3375	amiD	0.957
Rv2201	asnB	0.908
Rv2201	asnB	0.908
Rv2992c	gltS	0.902

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3009c.1	9	3frq_ERY_B_195 PDB CREDO	0.705	0.077	0.619	0.001
Rv3009c.1	9	3jwq_VIA_D_901 PDB CREDO	0.628	0.147	0.607	0.002
Rv3009c.1	9	3ut5_LOC_D_502 PDB CREDO	0.680	0.097	0.597	0.002
Rv3009c.1	22	3kw2_ADN_B_300 PDB CREDO	0.668	0.107	0.591	0.002
Rv3009c.1	9	2xpv_MIY_A_1209 PDB CREDO	0.652	0.122	0.588	0.003
Rv3009c.1	9	3bbt_FMM_D_91 PDB CREDO	0.605	0.173	0.585	0.003
Rv3009c.1	11	1uay_ADN_B_1002 PDB CREDO	0.617	0.159	0.582	0.003
Rv3009c.1	9	1hwi_115_A_2 PDB CREDO	0.601	0.178	0.581	0.003
Rv3009c.1	9	3e22_LOC_B_700 PDB CREDO	0.658	0.117	0.578	0.003
Rv3009c.1	9	3e22_LOC_D_700 PDB CREDO	0.658	0.117	0.578	0.003
Rv3009c.1	8	1hwk_117_C_4 PDB CREDO	0.576	0.208	0.576	0.003
Rv3009c.1	9	2h42_VIA_A_901 PDB CREDO	0.596	0.184	0.576	0.003
Rv3009c.1	8	1hwk_117_A_2 PDB CREDO	0.575	0.211	0.575	0.003
Rv3009c.1	22	1mx1_THA_A_1 PDB CREDO	0.573	0.213	0.573	0.003
Rv3009c.1	22	3sxr_1N1_B_2 PDB CREDO	0.620	0.156	0.571	0.004
Rv3009c.1	8	1hwk_117_B_1 PDB CREDO	0.602	0.176	0.568	0.004
Rv3009c.1	9	3ut5_LOC_B_502 PDB CREDO	0.688	0.090	0.568	0.004
Rv3009c.1	8	1hwk_117_D_3 PDB CREDO	0.602	0.177	0.567	0.004
Rv3009c.1	22	3sxr_1N1_A_1 PDB CREDO	0.637	0.137	0.564	0.004
Rv3009c.1	22	3tmz_06X_A_503 PDB CREDO	0.588	0.193	0.564	0.004
Rv3009c.1	9	3spk_TPV_A_100 PDB CREDO	0.563	0.226	0.563	0.004
Rv3009c.1	9	1hwi_115_D_3 PDB CREDO	0.641	0.133	0.563	0.004
Rv3009c.1	8	1hwl_FBI_B_1 PDB CREDO	0.579	0.205	0.562	0.004
Rv3009c.1	9	1lhv_NOG_A_301 PDB CREDO	0.620	0.155	0.562	0.004
Rv3009c.1	9	1zgy_BRL_A_503 PDB CREDO	0.562	0.228	0.562	0.004
Rv3009c.1	9	3rif_IVM_A_403 PDB CREDO	0.645	0.129	0.562	0.004
Rv3009c.1	8	1hwl_FBI_D_3 PDB CREDO	0.578	0.206	0.561	0.004
Rv3009c.1	8	3ut5_LOC_B_502 PDB CREDO	0.594	0.186	0.560	0.004
Rv3009c.1	11	1yi4_ADN_A_306 PDB CREDO	0.701	0.080	0.559	0.004
Rv3009c.1	9	1hwi_115_B_1 PDB CREDO	0.637	0.138	0.559	0.004
Rv3009c.1	22	1fmo_ADN_E_351 PDB CREDO	0.606	0.171	0.558	0.004
Rv3009c.1	8	1hwl_FBI_C_4 PDB CREDO	0.573	0.212	0.557	0.004
Rv3009c.1	8	1hwl_FBI_A_2 PDB CREDO	0.573	0.213	0.556	0.005
Rv3009c.1	9	1jg2_ADN_A_500 PDB CREDO	0.594	0.186	0.555	0.005
Rv3009c.1	9	3jwq_VIA_B_901 PDB CREDO	0.637	0.138	0.554	0.005
Rv3009c.1	11	1fb7_ROC_A_100 PDB CREDO	0.622	0.154	0.554	0.005
Rv3009c.1	9	3frq_ERY_A_195 PDB CREDO	0.734	0.057	0.554	0.005
Rv3009c.1	9	3rif_IVM_B_403 PDB CREDO	0.636	0.138	0.554	0.005
Rv3009c.1	9	3ri5_IVM_C_350 PDB CREDO	0.635	0.140	0.553	0.005
Rv3009c.1	9	3rif_IVM_A_402 PDB CREDO	0.635	0.140	0.553	0.005
Rv3009c.1	9	3rif_IVM_D_402 PDB CREDO	0.635	0.140	0.553	0.005
Rv3009c.1	9	3ria_IVM_C_349 PDB CREDO	0.634	0.140	0.552	0.005
Rv3009c.1	8	3ut5_LOC_D_502 PDB CREDO	0.624	0.152	0.552	0.005
Rv3009c.1	9	2xkw_P1B_B_1475 PDB CREDO	0.634	0.141	0.551	0.005
Rv3009c.1	9	1sa1_POD_B_700 PDB CREDO	0.705	0.077	0.548	0.005
Rv3009c.1	22	1fj8_CER_D_500 PDB CREDO	0.545	0.251	0.545	0.005
Rv3009c.1	9	2aa5_STR_B_302 PDB CREDO	0.563	0.226	0.544	0.005
Rv3009c.1	22	1m17_AQ4_A_999 PDB CREDO	0.567	0.220	0.544	0.005
Rv3009c.1	9	1sa1_POD_D_701 PDB CREDO	0.679	0.098	0.544	0.006
Rv3009c.1	9	3ria_IVM_E_349 PDB CREDO	0.698	0.082	0.544	0.006
Rv3009c.1	22	1uho_VDN_A_1000 PDB CREDO	0.543	0.253	0.543	0.006
Rv3009c.1	9	1nhz_486_A_800 PDB CREDO	0.543	0.254	0.543	0.006
Rv3009c.1	9	2h77_T3_A_1 PDB CREDO	0.543	0.254	0.543	0.006
Rv3009c.1	9	2aax_PDN_B_503 PDB CREDO	0.561	0.229	0.543	0.006
Rv3009c.1	9	2aa6_STR_B_402 PDB CREDO	0.560	0.230	0.542	0.006
Rv3009c.1	22	1fj8_CER_B_500 PDB CREDO	0.542	0.256	0.542	0.006
Rv3009c.1	9	3rhw_IVM_A_348 PDB CREDO	0.695	0.085	0.541	0.006
Rv3009c.1	9	2aa5_STR_A_301 PDB CREDO	0.559	0.231	0.541	0.006
Rv3009c.1	9	2aa6_STR_A_401 PDB CREDO	0.559	0.231	0.541	0.006
Rv3009c.1	9	2aax_PDN_A_502 PDB CREDO	0.559	0.231	0.541	0.006
Rv3009c.1	9	2h79_T3_A_1 PDB CREDO	0.559	0.232	0.540	0.006
Rv3009c.1	8	1sa1_POD_B_700 PDB CREDO	0.540	0.258	0.540	0.006
Rv3009c.1	9	1p93_DEX_A_1999 PDB CREDO	0.558	0.233	0.540	0.006
Rv3009c.1	9	1hwk_117_D_3 PDB CREDO	0.654	0.121	0.539	0.006
Rv3009c.1	9	1hwl_FBI_B_1 PDB CREDO	0.673	0.103	0.539	0.006
Rv3009c.1	9	1hwl_FBI_D_3 PDB CREDO	0.673	0.103	0.539	0.006
Rv3009c.1	9	1p93_DEX_B_2999 PDB CREDO	0.557	0.234	0.538	0.006
Rv3009c.1	22	2w9s_TOP_D_1158 PDB CREDO	0.538	0.261	0.538	0.006
Rv3009c.1	9	1ya3_STR_B_2001 PDB CREDO	0.576	0.209	0.538	0.006
Rv3009c.1	9	1z2b_VLB_C_800 PDB CREDO	0.671	0.105	0.537	0.006
Rv3009c.1	9	1hwi_115_C_4 PDB CREDO	0.575	0.210	0.537	0.006
Rv3009c.1	9	3ri5_IVM_A_349 PDB CREDO	0.690	0.088	0.537	0.006
Rv3009c.1	22	1fj8_CER_A_500 PDB CREDO	0.536	0.263	0.536	0.006
Rv3009c.1	22	3tbg_RTZ_A_1 PDB CREDO	0.536	0.263	0.536	0.006
Rv3009c.1	9	2y6o_1N1_A_1892 PDB CREDO	0.592	0.189	0.536	0.006
Rv3009c.1	9	1bsx_T3_A_1 PDB CREDO	0.572	0.214	0.536	0.006
Rv3009c.1	9	1bsx_T3_B_2 PDB CREDO	0.572	0.214	0.536	0.006
Rv3009c.1	9	1jg3_ADN_A_500 PDB CREDO	0.638	0.136	0.536	0.006
Rv3009c.1	9	4eyb_0WO_A_303 PDB CREDO	0.594	0.186	0.536	0.006
Rv3009c.1	22	2uxo_TAC_B_1211 PDB CREDO	0.582	0.202	0.536	0.006
Rv3009c.1	9	1uwh_BAX_A_1723 PDB CREDO	0.648	0.126	0.535	0.006
Rv3009c.1	9	3gws_T3_X_500 PDB CREDO	0.571	0.215	0.535	0.006
Rv3009c.1	9	1uwh_BAX_B_1723 PDB CREDO	0.647	0.127	0.534	0.006
Rv3009c.1	22	2fum_MIX_B_1539 PDB CREDO	0.580	0.204	0.534	0.006
Rv3009c.1	8	1sa1_POD_D_701 PDB CREDO	0.549	0.245	0.533	0.007
Rv3009c.1	9	1cil_ETS_A_263 PDB CREDO	0.551	0.242	0.533	0.007
Rv3009c.1	9	1ya3_STR_A_1001 PDB CREDO	0.570	0.216	0.533	0.007
Rv3009c.1	22	1fj8_CER_C_500 PDB CREDO	0.532	0.270	0.532	0.007
Rv3009c.1	9	3aod_RFP_C_2002 PDB CREDO	0.632	0.142	0.531	0.007
Rv3009c.1	9	3ria_IVM_E_348 PDB CREDO	0.681	0.096	0.531	0.007
Rv3009c.1	9	1hwl_FBI_C_4 PDB CREDO	0.662	0.113	0.530	0.007
Rv3009c.1	9	3rhw_IVM_D_348 PDB CREDO	0.680	0.097	0.529	0.007
Rv3009c.1	9	3ria_IVM_C_350 PDB CREDO	0.680	0.097	0.529	0.007
Rv3009c.1	9	3rhw_IVM_B_349 PDB CREDO	0.679	0.098	0.529	0.007
Rv3009c.1	9	3rhw_IVM_D_349 PDB CREDO	0.679	0.098	0.529	0.007
Rv3009c.1	9	1hwk_117_B_1 PDB CREDO	0.721	0.065	0.529	0.007
Rv3009c.1	9	1hwl_FBI_A_2 PDB CREDO	0.660	0.114	0.529	0.007
Rv3009c.1	39	3ond_ADN_A_506 PDB CREDO	0.550	0.244	0.529	0.007
Rv3009c.1	22	4agd_B49_A_2000 PDB CREDO	0.528	0.275	0.528	0.007
Rv3009c.1	9	3rhw_IVM_B_348 PDB CREDO	0.679	0.098	0.528	0.007
Rv3009c.1	22	2fum_MIX_C_2539 PDB CREDO	0.597	0.183	0.528	0.007
Rv3009c.1	9	2h42_VIA_B_902 PDB CREDO	0.606	0.171	0.528	0.007
Rv3009c.1	9	3ri5_IVM_B_349 PDB CREDO	0.678	0.099	0.528	0.007
Rv3009c.1	22	3nrr_D16_B_530 PDB CREDO	0.573	0.213	0.527	0.007
Rv3009c.1	9	3tne_RIT_A_401 PDB CREDO	0.601	0.178	0.527	0.007
Rv3009c.1	9	3ria_IVM_A_348 PDB CREDO	0.676	0.100	0.527	0.007
Rv3009c.1	9	1xzx_T3_X_500 PDB CREDO	0.581	0.203	0.526	0.007
Rv3009c.1	9	3tkd_CYZ_A_266 PDB CREDO	0.599	0.180	0.526	0.007
Rv3009c.1	9	2prg_BRL_A_1 PDB CREDO	0.583	0.200	0.526	0.007
Rv3009c.1	9	3qt0_486_A_4 PDB CREDO	0.544	0.252	0.526	0.007
Rv3009c.1	22	1mx1_THA_D_4 PDB CREDO	0.594	0.186	0.525	0.007
Rv3009c.1	9	1fm6_BRL_D_503 PDB CREDO	0.582	0.201	0.525	0.007
Rv3009c.1	9	2a69_RPT_M_8002 PDB CREDO	0.525	0.280	0.525	0.007
Rv3009c.1	9	3ri5_IVM_D_349 PDB CREDO	0.674	0.102	0.525	0.007
Rv3009c.1	9	3rif_IVM_E_402 PDB CREDO	0.674	0.102	0.525	0.007
Rv3009c.1	9	4eb6_VLB_C_503 PDB CREDO	0.603	0.175	0.525	0.007
Rv3009c.1	22	3kw2_ADN_A_300 PDB CREDO	0.665	0.110	0.524	0.008
Rv3009c.1	22	2bxf_DZP_B_2001 PDB CREDO	0.625	0.151	0.524	0.008
Rv3009c.1	9	1hwk_117_A_2 PDB CREDO	0.674	0.102	0.524	0.008
Rv3009c.1	9	1hwk_117_C_4 PDB CREDO	0.674	0.102	0.524	0.008
Rv3009c.1	9	2nni_MTK_A_501 PDB CREDO	0.693	0.086	0.523	0.008
Rv3009c.1	22	3hbb_TMQ_C_613 PDB CREDO	0.569	0.218	0.522	0.008
Rv3009c.1	22	1mx1_THA_F_6 PDB CREDO	0.590	0.192	0.522	0.008
Rv3009c.1	8	1hwi_115_D_3 PDB CREDO	0.589	0.192	0.522	0.008
Rv3009c.1	9	3h0a_9RA_A_500 PDB CREDO	0.539	0.259	0.521	0.008
Rv3009c.1	8	1hwi_115_B_1 PDB CREDO	0.588	0.194	0.520	0.008
Rv3009c.1	22	3qlg_1N1_B_601 PDB CREDO	0.611	0.166	0.520	0.008
Rv3009c.1	9	3oct_1N1_A_663 PDB CREDO	0.556	0.236	0.519	0.008
Rv3009c.1	9	3oht_1N1_B_1000 PDB CREDO	0.576	0.209	0.519	0.008
Rv3009c.1	9	3uvv_T3_A_501 PDB CREDO	0.573	0.213	0.519	0.008
Rv3009c.1	8	3frq_ERY_A_195 PDB CREDO	0.535	0.266	0.519	0.008
Rv3009c.1	9	1p93_DEX_C_3999 PDB CREDO	0.554	0.238	0.519	0.008
Rv3009c.1	9	1p93_DEX_D_4999 PDB CREDO	0.554	0.238	0.519	0.008
Rv3009c.1	9	3k2h_LYA_B_514 PDB CREDO	0.575	0.210	0.519	0.008
Rv3009c.1	22	3g0e_B49_A_9000 PDB CREDO	0.563	0.226	0.518	0.008
Rv3009c.1	22	3g5d_1N1_B_1 PDB CREDO	0.609	0.168	0.518	0.008
Rv3009c.1	8	3e22_LOC_B_700 PDB CREDO	0.585	0.198	0.518	0.008
Rv3009c.1	22	3adx_IMN_B_3 PDB CREDO	0.561	0.229	0.517	0.008
Rv3009c.1	9	1m2z_DEX_D_401 PDB CREDO	0.552	0.241	0.517	0.008
Rv3009c.1	9	2ab2_SNL_A_502 PDB CREDO	0.588	0.193	0.516	0.009
Rv3009c.1	8	3e22_LOC_D_700 PDB CREDO	0.583	0.200	0.516	0.009
Rv3009c.1	22	2gqg_1N1_A_501 PDB CREDO	0.705	0.077	0.516	0.009
Rv3009c.1	22	3clb_TMQ_A_611 PDB CREDO	0.562	0.227	0.516	0.009
Rv3009c.1	22	3mdv_CL6_A_506 PDB CREDO	0.615	0.161	0.516	0.009
Rv3009c.1	9	1uwj_BAX_A_1723 PDB CREDO	0.724	0.063	0.516	0.009
Rv3009c.1	9	2ab2_SNL_B_503 PDB CREDO	0.588	0.194	0.516	0.009
Rv3009c.1	22	3g5d_1N1_A_1 PDB CREDO	0.606	0.171	0.516	0.009
Rv3009c.1	22	3qlg_1N1_A_601 PDB CREDO	0.606	0.171	0.516	0.009
Rv3009c.1	9	3ln1_CEL_D_682 PDB CREDO	0.533	0.268	0.515	0.009
Rv3009c.1	9	1m2z_DEX_A_301 PDB CREDO	0.550	0.244	0.515	0.009
Rv3009c.1	22	3grv_ADN_A_300 PDB CREDO	0.643	0.131	0.515	0.009
Rv3009c.1	22	1udu_CIA_B_2003 PDB CREDO	0.537	0.263	0.514	0.009
Rv3009c.1	22	2bxf_DZP_A_2001 PDB CREDO	0.612	0.165	0.513	0.009
Rv3009c.1	22	3nrr_D16_A_530 PDB CREDO	0.536	0.264	0.513	0.009
Rv3009c.1	9	3f4x_KLT_A_300 PDB CREDO	0.659	0.116	0.513	0.009
Rv3009c.1	9	3h52_486_C_4 PDB CREDO	0.590	0.192	0.513	0.009
Rv3009c.1	22	3k54_1N1_A_1 PDB CREDO	0.675	0.102	0.512	0.009
Rv3009c.1	22	3b2r_VDN_A_1 PDB CREDO	0.584	0.199	0.512	0.009
Rv3009c.1	9	3gn8_DEX_B_247 PDB CREDO	0.547	0.248	0.512	0.009
Rv3009c.1	22	3nrr_D16_A_520 PDB CREDO	0.557	0.234	0.512	0.009
Rv3009c.1	22	2ity_IRE_A_2020 PDB CREDO	0.578	0.206	0.511	0.009
Rv3009c.1	9	3gn8_DEX_A_247 PDB CREDO	0.546	0.249	0.511	0.009
Rv3009c.1	9	3mne_DEX_A_784 PDB CREDO	0.546	0.249	0.511	0.009
Rv3009c.1	9	2q1v_PDN_A_248 PDB CREDO	0.547	0.247	0.511	0.009
Rv3009c.1	9	2oax_SNL_B_2001 PDB CREDO	0.581	0.203	0.510	0.009
Rv3009c.1	9	1fm6_BRL_X_504 PDB CREDO	0.562	0.227	0.509	0.009
Rv3009c.1	9	1uwj_BAX_B_1723 PDB CREDO	0.655	0.120	0.509	0.010
Rv3009c.1	8	2nni_MTK_A_501 PDB CREDO	0.524	0.282	0.509	0.010
Rv3009c.1	39	1v8b_ADN_C_2502 PDB CREDO	0.529	0.274	0.508	0.010
Rv3009c.1	9	2oax_SNL_C_3001 PDB CREDO	0.579	0.206	0.508	0.010
Rv3009c.1	9	1lhu_EST_A_301 PDB CREDO	0.563	0.226	0.508	0.010
Rv3009c.1	8	1hwi_115_A_2 PDB CREDO	0.631	0.144	0.507	0.010
Rv3009c.1	22	3b2r_VDN_B_1 PDB CREDO	0.577	0.208	0.506	0.010
Rv3009c.1	39	3ond_ADN_B_507 PDB CREDO	0.550	0.244	0.506	0.010
Rv3009c.1	9	2h42_VIA_C_903 PDB CREDO	0.581	0.202	0.506	0.010
Rv3009c.1	22	1xp0_VDN_A_201 PDB CREDO	0.527	0.277	0.505	0.010
Rv3009c.1	22	3uq6_ADN_A_401 PDB CREDO	0.631	0.144	0.505	0.010
Rv3009c.1	9	2hw2_RFP_A_1200 PDB CREDO	0.575	0.210	0.505	0.010
Rv3009c.1	22	3fuu_ADN_A_0 PDB CREDO	0.593	0.187	0.505	0.010
Rv3009c.1	9	3vhu_SNL_A_1001 PDB CREDO	0.575	0.211	0.504	0.010
Rv3009c.1	22	1udt_VIA_A_1000 PDB CREDO	0.573	0.213	0.503	0.010
Rv3009c.1	9	3tkd_CYZ_B_267 PDB CREDO	0.609	0.168	0.503	0.010
Rv3009c.1	22	3vri_1KX_A_301 PDB CREDO	0.567	0.220	0.502	0.011
Rv3009c.1	9	3h52_486_D_2 PDB CREDO	0.608	0.170	0.502	0.011
Rv3009c.1	22	1s9p_DES_B_459 PDB CREDO	0.566	0.221	0.501	0.011
Rv3009c.1	9	2prg_BRL_B_2 PDB CREDO	0.556	0.236	0.501	0.011
Rv3009c.1	9	1uob_PNN_A_1311 PDB CREDO	0.625	0.150	0.501	0.011
Rv3009c.1	9	2vke_TAC_A_222 PDB CREDO	0.668	0.107	0.501	0.011
Rv3009c.1	22	1s9p_DES_C_500 PDB CREDO	0.566	0.223	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
zincPubChem	0.849	65.409
aspartatePubChem	0.823	133.103
magnesiumPubChem	0.798	24.305
manganesePubChem	0.788	54.938
L-asparaginePubChem	0.788	132.118
adenosine diphosphatePubChem	0.788	427.201
polyglutaminePubChem	0.788	146.145
adenosine triphosphatePubChem	0.705	507.181
5'-O-[N-(L-glutamyl)-sulfamoyl] adenosinePubChem	0.701	475.434