SInCRe - Rv2436

Tuberculist information

Gene name	rbsK
Protein function	Ribokinase RbsK
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	2733.23
Molecular mass(da)	30280.2
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 304

	  		  	1    MANASETNVGPMAPRVCVVGSVNMDLTFVVDALPRPGETVLAASLTRTPGGKGANQAVAA   60
			  	61   ARAGAQVQFSGAFGDDPAAAQLRAHLRANAVGLDRTVTVPGPSGTAIIVVDASAENTVLV  120
			  	121  APGANAHLTPVPSAVANCDVLLTQLEIPVATALAAARAAQSADAVVMVNASPAGQDRSSL  180
			  	181  QDLAAIADVVIANEHEANDWPSPPTHFVITLGVRGARYVGADGVFEVPAPTVTPVDTAGA  240
			  	241  GDVFAGVLAANWPRNPGSPAERLRALRRACAAGALATLVSGVGDCAPAAAAIDAALRANR  300
			  	301  HNGS

Known structures in the PDB

	PDB ID	3GO6
	Total residue count	620
	Number of chains	2
	Method	X-RAY
	Resolution	1.98

	PDB ID	3GO7
	Total residue count	620
	Number of chains	2
	Method	X-RAY
	Resolution	2.5

Number of amino acids : 304

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
PfkB	PF00294	13-289

Mtb Structural Proteome models

Model Number	1
Model name	Rv2436_3go6_A
Template	3GO6 APDB CREDO
Template coverage	13_299
Template Identity(%)	100.0
Model coverage(%)	93.8
Normalized DOPE score	-1.517

Model Number	2
Model name	Rv2436
Template	1RKD APDB CREDO
Template coverage	4_309
Template Identity(%)	37.5
Model coverage(%)	94.1
Normalized DOPE score	-0.027

Structure Models from Chopin

Model Number	1
Profile	c.72.1.1 - 3.40.1190.20 Click for model details
zscore	27.56
Residue begin	1
Residue end	304

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2436	Gene name	Confidence Score
Rv0478	deoC	0.995
Rv1449c	tkt	0.984
Rv1449c	tkt	0.984
Rv1449c	tkt	0.984
Rv3393	iunH	0.98
Rv1017c	prsA	0.977
Rv1017c	prsA	0.977
Rv2465c	rpiB	0.951
Rv3068c	pgmA	0.93
Rv3068c	pgmA	0.93
Rv3068c	pgmA	0.93
Rv3068c	pgmA	0.93

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2436_3go6_A	2	3q70_RIT_A_2001 PDB CREDO	0.648	0.126	0.629	0.001
Rv2436_3go6_A	2	2nni_MTK_A_501 PDB CREDO	0.652	0.122	0.596	0.002
Rv2436_3go6_A	12	2zva_1N1_A_513 PDB CREDO	0.580	0.204	0.580	0.003
Rv2436_3go6_A	2	3tne_RIT_A_401 PDB CREDO	0.610	0.168	0.573	0.003
Rv2436_3go6_A	2	3ut5_LOC_B_502 PDB CREDO	0.569	0.218	0.569	0.004
Rv2436_3go6_A	2	3tne_RIT_B_401 PDB CREDO	0.601	0.178	0.565	0.004
Rv2436_3go6_A	2	3d91_REM_B_350 PDB CREDO	0.595	0.185	0.560	0.004
Rv2436_3go6_A	2	3d91_REM_A_350 PDB CREDO	0.593	0.187	0.559	0.004
Rv2436_3go6_A	12	2y7j_B49_B_1294 PDB CREDO	0.576	0.210	0.553	0.005
Rv2436_3go6_A	2	3ut5_LOC_D_502 PDB CREDO	0.587	0.195	0.552	0.005
Rv2436_3go6_A	2	3so9_017_A_100 PDB CREDO	0.547	0.248	0.547	0.005
Rv2436_3go6_A	12	3g5d_1N1_B_1 PDB CREDO	0.568	0.220	0.546	0.005
Rv2436_3go6_A	12	3qlg_1N1_A_601 PDB CREDO	0.568	0.220	0.546	0.005
Rv2436_3go6_A	12	3g5d_1N1_A_1 PDB CREDO	0.565	0.224	0.543	0.006
Rv2436_3go6_A	2	1uwh_BAX_B_1723 PDB CREDO	0.541	0.256	0.541	0.006
Rv2436_3go6_A	2	1uwh_BAX_A_1723 PDB CREDO	0.541	0.257	0.541	0.006
Rv2436_3go6_A	12	3qlg_1N1_B_601 PDB CREDO	0.562	0.227	0.541	0.006
Rv2436_3go6_A	2	1lhv_NOG_A_301 PDB CREDO	0.593	0.187	0.540	0.006
Rv2436_3go6_A	2	1sa1_POD_D_701 PDB CREDO	0.557	0.235	0.540	0.006
Rv2436_3go6_A	2	3tkd_CYZ_B_267 PDB CREDO	0.536	0.264	0.536	0.006
Rv2436_3go6_A	2	1hwl_FBI_B_1 PDB CREDO	0.545	0.250	0.529	0.007
Rv2436_3go6_A	12	3lfa_1N1_A_361 PDB CREDO	0.597	0.183	0.528	0.007
Rv2436_3go6_A	2	1hwl_FBI_D_3 PDB CREDO	0.544	0.252	0.528	0.007
Rv2436_3go6_A	2	1hwk_117_D_3 PDB CREDO	0.526	0.279	0.526	0.007
Rv2436_3go6_A	2	1sa1_POD_B_700 PDB CREDO	0.558	0.233	0.525	0.007
Rv2436_3go6_A	2	1hwk_117_B_1 PDB CREDO	0.590	0.191	0.524	0.008
Rv2436_3go6_A	12	3ti1_B49_A_299 PDB CREDO	0.543	0.254	0.522	0.008
Rv2436_3go6_A	2	1hwl_FBI_A_2 PDB CREDO	0.535	0.266	0.519	0.008
Rv2436_3go6_A	12	1s9p_DES_B_459 PDB CREDO	0.518	0.290	0.518	0.008
Rv2436_3go6_A	2	1hwl_FBI_C_4 PDB CREDO	0.533	0.268	0.517	0.008
Rv2436_3go6_A	2	1z2b_VLB_C_800 PDB CREDO	0.533	0.268	0.517	0.008
Rv2436_3go6_A	12	1s9p_DES_C_500 PDB CREDO	0.517	0.292	0.517	0.008
Rv2436_3go6_A	2	1hwk_117_A_2 PDB CREDO	0.547	0.248	0.515	0.009
Rv2436_3go6_A	2	3tkd_CYZ_A_266 PDB CREDO	0.548	0.247	0.515	0.009
Rv2436_3go6_A	2	1hwk_117_C_4 PDB CREDO	0.546	0.250	0.514	0.009
Rv2436_3go6_A	12	1kij_NOV_B_444 PDB CREDO	0.555	0.237	0.514	0.009
Rv2436_3go6_A	12	2x1l_ADN_C_601 PDB CREDO	0.660	0.115	0.512	0.009
Rv2436_3go6_A	12	1ki3_PE2_A_1 PDB CREDO	0.511	0.302	0.511	0.009
Rv2436_3go6_A	2	3pww_ROC_A_1001 PDB CREDO	0.677	0.099	0.510	0.009
Rv2436_3go6_A	12	1g50_EST_A_600 PDB CREDO	0.527	0.278	0.506	0.010
Rv2436_3go6_A	2	2v0z_C41_O_1327 PDB CREDO	0.687	0.091	0.504	0.010
Rv2436_3go6_A	12	3ols_EST_A_600 PDB CREDO	0.522	0.284	0.502	0.011
Rv2436_3go6_A	2	1uwj_BAX_A_1723 PDB CREDO	0.580	0.203	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
adenosine diphosphatePubChem	0.997	427.201
D-ribosePubChem	0.997	150.13
magnesiumPubChem	0.974	24.305
ribosePubChem	0.972	150.13
CHEBI:45506PubChem	0.96	150.13
adenosine triphosphatePubChem	0.905	507.181
D-ribose 5-phosphatePubChem	0.9	230.11
deoxyribose 5-phosphatePubChem	0.9	214.11
H(+)PubChem	0.9	2.01588
protiumPubChem	0.9	2.01576
deuteriumPubChem	0.9	2.01588
2-deoxy-d-ribose-5-phosphatePubChem	0.9	214.11
beta-D-ribofuranosePubChem	0.9	150.13