SInCRe - Rv2399c

Tuberculist information

Gene name	cysT
Protein function	Probable sulfate-transport integral membrane protein ABC transporter CysT
Functional category(tuberculist)	cell wall and cell processes
Gene location(kb)	2695.8
Molecular mass(da)	29682.9
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 283

	  		  	1    MTESLVGERRAPQFRARLSGPAGPPSVRVGMAVVWLSVIVLLPLAAIVWQAAGGGWRAFW   60
			  	61   LAVSSHAAMESFRVTLTISTAVTVINLVFGLLIAWVLVRDDFAGKRIVDAIIDLPFALPT  120
			  	121  IVASLVMLALYGNNSPVGLHFQHTATGVGVALAFVTLPFVVRAVQPVLLEIDRETEEAAA  180
			  	181  SLGANGAKIFTSVVLPSLTPALLSGAGLAFSRAIGEFGSVVLIGGAVPGKTEVSSQWIRT  240
			  	241  LIENDDRTGAAAISVVLLSISFIVLLILRVVGARAAKREEMAA

Known structures in the PDB

No Known structures

Number of amino acids : 283

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
BPD_transp_1	PF00528	86-278

Mtb Structural Proteome models

Model Number	1
Model name	Rv2399c
Template	1L7V APDB CREDO
Template coverage	45_260
Template Identity(%)	16.8
Model coverage(%)	75.3
Normalized DOPE score	0.461

Model Number	2
Model name	Rv2399c.2
Template	4DCG APDB CREDO
Template coverage	10_223
Template Identity(%)	9.6
Model coverage(%)	81.6
Normalized DOPE score	1.359

Structure Models from Chopin

Model Number	1
Profile	f.58.1.1 - 1.10.3720.10 Click for model details
zscore	18.28
Residue begin
Residue end

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2399c	Gene name	Confidence Score
Rv2397c	cysA1	0.999
Rv2397c	cysA1	0.999
Rv2400c	subI	0.999
Rv2398c	cysW	0.997
Rv1286	cysN	0.992
Rv1286	cysN	0.992
Rv1286	cysN	0.992
Rv1285	cysD	0.988
Rv1848	ureA	0.925

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2399c.2	1	1ie4_T44_A_128 PDB CREDO	0.581	0.203	0.581	0.003
Rv2399c.2	1	3lfa_1N1_A_361 PDB CREDO	0.604	0.175	0.579	0.003
Rv2399c.2	1	1sn5_T3_C_601 PDB CREDO	0.603	0.176	0.578	0.003
Rv2399c.2	1	4dta_ADN_A_401 PDB CREDO	0.680	0.097	0.572	0.003
Rv2399c.2	1	3r9c_ECL_A_452 PDB CREDO	0.596	0.184	0.571	0.004
Rv2399c.2	1	2ity_IRE_A_2020 PDB CREDO	0.616	0.160	0.569	0.004
Rv2399c.2	1	2zva_1N1_A_513 PDB CREDO	0.616	0.160	0.569	0.004
Rv2399c.2	1	3qlg_1N1_B_601 PDB CREDO	0.636	0.139	0.564	0.004
Rv2399c.2	1	3g5d_1N1_B_1 PDB CREDO	0.634	0.141	0.562	0.004
Rv2399c.2	1	3g5d_1N1_A_1 PDB CREDO	0.633	0.142	0.561	0.004
Rv2399c.2	1	2itz_IRE_A_2021 PDB CREDO	0.584	0.198	0.561	0.004
Rv2399c.2	1	3qlg_1N1_A_601 PDB CREDO	0.631	0.144	0.560	0.004
Rv2399c.2	6	1xkk_FMM_A_91 PDB CREDO	0.670	0.105	0.551	0.005
Rv2399c.2	6	1t46_STI_A_3 PDB CREDO	0.706	0.076	0.550	0.005
Rv2399c.2	1	2y7j_B49_B_1294 PDB CREDO	0.571	0.215	0.549	0.005
Rv2399c.2	1	1uay_ADN_A_1001 PDB CREDO	0.681	0.096	0.548	0.005
Rv2399c.2	1	1sn0_T44_C_601 PDB CREDO	0.635	0.139	0.535	0.006
Rv2399c.2	6	3sm2_478_A_126 PDB CREDO	0.616	0.161	0.532	0.007
Rv2399c.2	1	3oht_1N1_A_1000 PDB CREDO	0.647	0.127	0.532	0.007
Rv2399c.2	1	1ie4_T44_B_328 PDB CREDO	0.595	0.185	0.528	0.007
Rv2399c.2	1	1sn5_T3_D_602 PDB CREDO	0.626	0.149	0.527	0.007
Rv2399c.2	1	1m17_AQ4_A_999 PDB CREDO	0.526	0.279	0.526	0.007
Rv2399c.2	1	1d4f_ADN_A_601 PDB CREDO	0.569	0.218	0.525	0.007
Rv2399c.2	1	2y7j_B49_D_1294 PDB CREDO	0.622	0.153	0.524	0.008
Rv2399c.2	6	2xkw_P1B_A_1478 PDB CREDO	0.617	0.159	0.520	0.008
Rv2399c.2	6	3prs_RIT_A_1001 PDB CREDO	0.570	0.217	0.518	0.008
Rv2399c.2	1	2ito_IRE_A_2020 PDB CREDO	0.605	0.174	0.516	0.009
Rv2399c.2	1	3ads_IMN_B_3 PDB CREDO	0.561	0.229	0.515	0.009
Rv2399c.2	1	2yja_EST_B_1550 PDB CREDO	0.536	0.264	0.514	0.009
Rv2399c.2	1	4dt8_ADN_A_401 PDB CREDO	0.609	0.168	0.513	0.009
Rv2399c.2	6	1uwj_BAX_A_1723 PDB CREDO	0.753	0.046	0.512	0.009
Rv2399c.2	1	1g50_EST_A_600 PDB CREDO	0.532	0.269	0.511	0.009
Rv2399c.2	1	3ols_EST_A_600 PDB CREDO	0.532	0.269	0.511	0.009
Rv2399c.2	1	3uud_EST_A_600 PDB CREDO	0.531	0.272	0.509	0.009
Rv2399c.2	6	1ya4_CTX_A_1 PDB CREDO	0.547	0.248	0.509	0.009
Rv2399c.2	1	3ols_EST_B_600 PDB CREDO	0.530	0.273	0.509	0.010
Rv2399c.2	1	2fum_MIX_B_1539 PDB CREDO	0.527	0.277	0.506	0.010
Rv2399c.2	1	1pg2_ADN_A_552 PDB CREDO	0.658	0.117	0.505	0.010
Rv2399c.2	1	3kw2_ADN_B_300 PDB CREDO	0.548	0.247	0.505	0.010
Rv2399c.2	1	1jzs_MRC_A_1301 PDB CREDO	0.592	0.189	0.505	0.010
Rv2399c.2	1	1kij_NOV_B_444 PDB CREDO	0.592	0.189	0.505	0.010
Rv2399c.2	1	3kw2_ADN_A_300 PDB CREDO	0.614	0.163	0.505	0.010
Rv2399c.2	1	1jg3_ADN_B_550 PDB CREDO	0.567	0.221	0.503	0.010
Rv2399c.2	1	3uud_EST_B_600 PDB CREDO	0.524	0.282	0.503	0.010
Rv2399c.2	1	2uxo_TAC_B_1211 PDB CREDO	0.521	0.286	0.500	0.011
Rv2399c.2	1	3adx_IMN_B_3 PDB CREDO	0.521	0.286	0.500	0.011
Rv2399c.2	6	1c6z_ROC_B_505 PDB CREDO	0.564	0.224	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
sulfatePubChem	0.954	96.0626
phosphatePubChem	0.915	96.9872
hydroxyl radicalsPubChem	0.906	17.0073
adenosine triphosphatePubChem	0.9	507.181
adenosine diphosphatePubChem	0.9	427.201