SInCRe - Rv1849

Tuberculist information

Gene name	ureB
Protein function	Urease beta subunit UreB (urea amidohydrolase)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	2097.65
Molecular mass(da)	11189.9
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 104

	  		  	1    MIPGEIFYGSGDIEMNAAALSRLQMRIINAGDRPVQVGSHVHLPQANRALSFDRATAHGY   60
			  	61   RLDIPAATAVRFEPGIPQIVGLVPLGGRREVPGLTLNPPGRLDR

Known structures in the PDB

No Known structures

Number of amino acids : 104

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Urease_beta	PF00699	2-102

Mtb Structural Proteome models

Structure Models from Chopin

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Potential ligand/drug binding sites

No binding sites identified

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions