SInCRe - Rv1207

Tuberculist information

Gene name	folP2
Protein function	Dihydropteroate synthase 2 FolP2 (DHPS 2) (dihydropteroate pyrophosphorylase 2)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	1351.19
Molecular mass(da)	33013.7
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 318

	  		  	1    VRSTPPASAGRSTPPALAGHSTPPALAGHSTLCGRPVAGDRALIMAIVNRTPDSFYDKGA   60
			  	61   TFSDAAARDAVHRAVADGADVIDVGGVKAGPGERVDVDTEITRLVPFIEWLRGAYPDQLI  120
			  	121  SVDTWRAQVAKAACAAGADLINDTWGGVDPAMPEVAAEFGAGLVCAHTGGALPRTRPFRV  180
			  	181  SYGTTTRGVVDAVISQVTAAAERAVAAGVAREKVLIDPAHDFGKNTFHGLLLLRHVADLV  240
			  	241  MTGWPVLMALSNKDVVGETLGVDLTERLEGTLAATALAAAAGARMFRVHEVAATRRVLEM  300
			  	301  VASIQGVRPPTRTVRGLA

Known structures in the PDB

	PDB ID	2VP8
	Total residue count	636
	Number of chains	2
	Method	X-RAY
	Resolution	2.64

Number of amino acids : 318

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Pterin_bind	PF00809	47-257

Mtb Structural Proteome models

Model Number	1
Model name	Rv1207_2vp8_A
Template	2VP8 APDB CREDO
Template coverage	27_311
Template Identity(%)	100.0
Model coverage(%)	89.3
Normalized DOPE score	-1.377

Model Number	2
Model name	Rv1207
Template	1AJ0 APDB CREDO
Template coverage	7_277
Template Identity(%)	33.9
Model coverage(%)	86.5
Normalized DOPE score	-0.277

Structure Models from Chopin

Model Number	1
Profile	c.1.21.1 - 3.20.20.20 Click for model details
zscore	48.01
Residue begin	2
Residue end	318

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1207	Gene name	Confidence Score
Rv3606c	folK	0.999
Rv2447c	folC	0.993
Rv2447c	folC	0.993
Rv3607c	folB	0.992
Rv2763c	dfrA	0.952
Rv3609c	folE	0.921
Rv0812	Rv0812	0.905

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1207_2vp8_A	4	2y6o_1N1_A_1892 PDB CREDO	0.641	0.133	0.621	0.001
Rv1207_2vp8_A	4	1xzx_T3_X_500 PDB CREDO	0.628	0.147	0.609	0.002
Rv1207_2vp8_A	4	3uvv_T3_A_501 PDB CREDO	0.625	0.151	0.605	0.002
Rv1207_2vp8_A	4	1bsx_T3_A_1 PDB CREDO	0.644	0.130	0.604	0.002
Rv1207_2vp8_A	4	1bsx_T3_B_2 PDB CREDO	0.644	0.130	0.604	0.002
Rv1207_2vp8_A	4	3gws_T3_X_500 PDB CREDO	0.635	0.140	0.595	0.002
Rv1207_2vp8_A	4	3tkd_CYZ_A_266 PDB CREDO	0.595	0.185	0.595	0.002
Rv1207_2vp8_A	4	1fm6_BRL_X_504 PDB CREDO	0.613	0.164	0.594	0.002
Rv1207_2vp8_A	4	2h79_T3_A_1 PDB CREDO	0.652	0.123	0.592	0.002
Rv1207_2vp8_A	4	3oez_STI_B_601 PDB CREDO	0.591	0.190	0.591	0.002
Rv1207_2vp8_A	4	1zgy_BRL_A_503 PDB CREDO	0.671	0.105	0.589	0.003
Rv1207_2vp8_A	4	3hec_STI_A_1 PDB CREDO	0.589	0.193	0.589	0.003
Rv1207_2vp8_A	4	1uwh_BAX_A_1723 PDB CREDO	0.626	0.149	0.588	0.003
Rv1207_2vp8_A	4	3ut5_LOC_D_502 PDB CREDO	0.588	0.194	0.588	0.003
Rv1207_2vp8_A	4	1uwh_BAX_B_1723 PDB CREDO	0.624	0.151	0.586	0.003
Rv1207_2vp8_A	4	3tkd_CYZ_B_267 PDB CREDO	0.623	0.153	0.585	0.003
Rv1207_2vp8_A	4	3frq_ERY_B_195 PDB CREDO	0.580	0.203	0.580	0.003
Rv1207_2vp8_A	4	4asd_BAX_A_1500 PDB CREDO	0.655	0.120	0.579	0.003
Rv1207_2vp8_A	4	2h77_T3_A_1 PDB CREDO	0.656	0.119	0.576	0.003
Rv1207_2vp8_A	4	1hwi_115_B_1 PDB CREDO	0.575	0.210	0.575	0.003
Rv1207_2vp8_A	4	1uob_PNN_A_1311 PDB CREDO	0.629	0.146	0.574	0.003
Rv1207_2vp8_A	4	1hwi_115_D_3 PDB CREDO	0.574	0.212	0.574	0.003
Rv1207_2vp8_A	4	3e22_LOC_D_700 PDB CREDO	0.574	0.212	0.574	0.003
Rv1207_2vp8_A	4	1y0x_T44_X_500 PDB CREDO	0.610	0.168	0.573	0.003
Rv1207_2vp8_A	4	3bbt_FMM_D_91 PDB CREDO	0.674	0.102	0.572	0.003
Rv1207_2vp8_A	4	3e22_LOC_B_700 PDB CREDO	0.571	0.215	0.571	0.004
Rv1207_2vp8_A	4	2hw2_RFP_A_1200 PDB CREDO	0.568	0.219	0.568	0.004
Rv1207_2vp8_A	4	3spk_TPV_A_100 PDB CREDO	0.647	0.128	0.568	0.004
Rv1207_2vp8_A	4	3heg_BAX_A_1 PDB CREDO	0.622	0.154	0.567	0.004
Rv1207_2vp8_A	4	1sa1_POD_B_700 PDB CREDO	0.638	0.136	0.565	0.004
Rv1207_2vp8_A	4	3gcs_BAX_A_401 PDB CREDO	0.638	0.137	0.565	0.004
Rv1207_2vp8_A	4	2jfa_RAL_A_600 PDB CREDO	0.564	0.224	0.564	0.004
Rv1207_2vp8_A	4	1uwj_BAX_B_1723 PDB CREDO	0.635	0.139	0.562	0.004
Rv1207_2vp8_A	4	1sa1_POD_D_701 PDB CREDO	0.616	0.160	0.562	0.004
Rv1207_2vp8_A	4	2xkw_P1B_B_1475 PDB CREDO	0.731	0.059	0.558	0.004
Rv1207_2vp8_A	4	1uwj_BAX_A_1723 PDB CREDO	0.686	0.092	0.556	0.005
Rv1207_2vp8_A	4	3vn2_TLS_A_501 PDB CREDO	0.570	0.217	0.552	0.005
Rv1207_2vp8_A	4	1fm6_BRL_D_503 PDB CREDO	0.696	0.084	0.551	0.005
Rv1207_2vp8_A	4	1s9p_DES_A_459 PDB CREDO	0.696	0.084	0.551	0.005
Rv1207_2vp8_A	4	3ut5_LOC_B_502 PDB CREDO	0.586	0.196	0.551	0.005
Rv1207_2vp8_A	4	1err_RAL_B_600 PDB CREDO	0.565	0.223	0.548	0.005
Rv1207_2vp8_A	4	2jfa_RAL_B_600 PDB CREDO	0.565	0.223	0.548	0.005
Rv1207_2vp8_A	4	1err_RAL_A_600 PDB CREDO	0.564	0.224	0.547	0.005
Rv1207_2vp8_A	4	3tne_RIT_A_401 PDB CREDO	0.547	0.249	0.547	0.005
Rv1207_2vp8_A	4	2hyy_STI_B_600 PDB CREDO	0.598	0.181	0.545	0.005
Rv1207_2vp8_A	4	2fum_MIX_D_3539 PDB CREDO	0.642	0.133	0.545	0.005
Rv1207_2vp8_A	4	3qt0_486_A_4 PDB CREDO	0.642	0.133	0.545	0.005
Rv1207_2vp8_A	4	3oct_1N1_A_663 PDB CREDO	0.661	0.114	0.542	0.006
Rv1207_2vp8_A	4	1jg2_ADN_A_500 PDB CREDO	0.661	0.114	0.542	0.006
Rv1207_2vp8_A	4	2oiq_STI_A_1001 PDB CREDO	0.593	0.187	0.541	0.006
Rv1207_2vp8_A	4	3spk_TPV_B_100 PDB CREDO	0.629	0.146	0.540	0.006
Rv1207_2vp8_A	4	3oht_1N1_B_1000 PDB CREDO	0.682	0.095	0.540	0.006
Rv1207_2vp8_A	4	1hwi_115_A_2 PDB CREDO	0.594	0.186	0.539	0.006
Rv1207_2vp8_A	4	1lhv_NOG_A_301 PDB CREDO	0.557	0.235	0.539	0.006
Rv1207_2vp8_A	4	1qkn_RAL_A_600 PDB CREDO	0.574	0.211	0.539	0.006
Rv1207_2vp8_A	4	2prg_BRL_A_1 PDB CREDO	0.678	0.099	0.537	0.006
Rv1207_2vp8_A	4	1t46_STI_A_3 PDB CREDO	0.758	0.043	0.536	0.006
Rv1207_2vp8_A	4	1hwk_117_B_1 PDB CREDO	0.639	0.135	0.534	0.006
Rv1207_2vp8_A	4	1hwk_117_D_3 PDB CREDO	0.567	0.220	0.533	0.007
Rv1207_2vp8_A	4	1hwl_FBI_B_1 PDB CREDO	0.585	0.198	0.533	0.007
Rv1207_2vp8_A	4	1hwl_FBI_D_3 PDB CREDO	0.585	0.198	0.533	0.007
Rv1207_2vp8_A	4	3jwq_VIA_D_901 PDB CREDO	0.628	0.147	0.533	0.007
Rv1207_2vp8_A	4	1xkk_FMM_A_91 PDB CREDO	0.793	0.027	0.532	0.007
Rv1207_2vp8_A	4	4eyb_0WO_A_303 PDB CREDO	0.671	0.105	0.531	0.007
Rv1207_2vp8_A	4	2pl0_STI_A_200 PDB CREDO	0.582	0.201	0.531	0.007
Rv1207_2vp8_A	4	3v5w_8PR_A_701 PDB CREDO	0.563	0.227	0.528	0.007
Rv1207_2vp8_A	4	1hwl_FBI_C_4 PDB CREDO	0.578	0.206	0.527	0.007
Rv1207_2vp8_A	4	3ln1_CEL_A_682 PDB CREDO	0.562	0.228	0.527	0.007
Rv1207_2vp8_A	4	3ln1_CEL_B_682 PDB CREDO	0.562	0.228	0.527	0.007
Rv1207_2vp8_A	4	3ln1_CEL_C_682 PDB CREDO	0.561	0.229	0.526	0.007
Rv1207_2vp8_A	4	1hwk_117_A_2 PDB CREDO	0.593	0.187	0.525	0.007
Rv1207_2vp8_A	4	3frq_ERY_A_195 PDB CREDO	0.610	0.167	0.524	0.008
Rv1207_2vp8_A	4	1hwk_117_C_4 PDB CREDO	0.592	0.189	0.524	0.008
Rv1207_2vp8_A	4	3ln1_CEL_D_682 PDB CREDO	0.615	0.161	0.522	0.008
Rv1207_2vp8_A	4	1hwl_FBI_A_2 PDB CREDO	0.572	0.214	0.522	0.008
Rv1207_2vp8_A	4	1cil_ETS_A_263 PDB CREDO	0.611	0.166	0.519	0.008
Rv1207_2vp8_A	4	1jg3_ADN_A_500 PDB CREDO	0.701	0.080	0.516	0.009
Rv1207_2vp8_A	4	3tne_RIT_B_401 PDB CREDO	0.514	0.296	0.514	0.009
Rv1207_2vp8_A	4	1z2b_VLB_C_800 PDB CREDO	0.563	0.225	0.514	0.009
Rv1207_2vp8_A	4	3oht_1N1_A_1000 PDB CREDO	0.723	0.065	0.513	0.009
Rv1207_2vp8_A	4	1s9p_DES_D_600 PDB CREDO	0.647	0.128	0.512	0.009
Rv1207_2vp8_A	4	2h42_VIA_A_901 PDB CREDO	0.603	0.175	0.512	0.009
Rv1207_2vp8_A	4	3ms9_STI_B_1 PDB CREDO	0.612	0.165	0.511	0.009
Rv1207_2vp8_A	4	3mss_STI_B_1 PDB CREDO	0.611	0.166	0.510	0.009
Rv1207_2vp8_A	4	3pyy_STI_A_3 PDB CREDO	0.611	0.166	0.510	0.009
Rv1207_2vp8_A	4	3b0w_DGX_B_1 PDB CREDO	0.646	0.128	0.510	0.009
Rv1207_2vp8_A	4	3oez_STI_A_601 PDB CREDO	0.610	0.167	0.509	0.009
Rv1207_2vp8_A	4	3mss_STI_D_1 PDB CREDO	0.609	0.169	0.508	0.010
Rv1207_2vp8_A	4	1iep_STI_B_202 PDB CREDO	0.608	0.169	0.508	0.010
Rv1207_2vp8_A	4	1kij_NOV_A_400 PDB CREDO	0.598	0.182	0.507	0.010
Rv1207_2vp8_A	4	3bbt_FMM_B_91 PDB CREDO	0.742	0.052	0.507	0.010
Rv1207_2vp8_A	4	2hyy_STI_A_600 PDB CREDO	0.608	0.170	0.507	0.010
Rv1207_2vp8_A	4	2hyy_STI_D_600 PDB CREDO	0.608	0.170	0.507	0.010
Rv1207_2vp8_A	4	3h0a_9RA_A_500 PDB CREDO	0.597	0.182	0.507	0.010
Rv1207_2vp8_A	4	3k5v_STI_B_2 PDB CREDO	0.607	0.171	0.507	0.010
Rv1207_2vp8_A	4	3ms9_STI_A_1 PDB CREDO	0.607	0.171	0.506	0.010
Rv1207_2vp8_A	4	3mss_STI_C_1 PDB CREDO	0.607	0.171	0.506	0.010
Rv1207_2vp8_A	4	3mss_STI_A_1 PDB CREDO	0.606	0.172	0.506	0.010
Rv1207_2vp8_A	4	3pyy_STI_B_4 PDB CREDO	0.606	0.172	0.506	0.010
Rv1207_2vp8_A	4	3vhu_SNL_A_1001 PDB CREDO	0.505	0.311	0.505	0.010
Rv1207_2vp8_A	4	1iep_STI_A_201 PDB CREDO	0.605	0.173	0.505	0.010
Rv1207_2vp8_A	4	3erd_DES_B_800 PDB CREDO	0.660	0.114	0.504	0.010
Rv1207_2vp8_A	4	3k54_1N1_A_1 PDB CREDO	0.685	0.093	0.504	0.010
Rv1207_2vp8_A	8	1v8b_ADN_B_1502 PDB CREDO	0.504	0.311	0.504	0.010
Rv1207_2vp8_A	4	3gp0_NIL_A_1 PDB CREDO	0.732	0.059	0.504	0.010
Rv1207_2vp8_A	4	2hyy_STI_C_600 PDB CREDO	0.604	0.175	0.504	0.010
Rv1207_2vp8_A	4	3gvu_STI_A_1001 PDB CREDO	0.604	0.175	0.504	0.010
Rv1207_2vp8_A	4	2oax_SNL_B_2001 PDB CREDO	0.502	0.315	0.502	0.011
Rv1207_2vp8_A	4	2oax_SNL_C_3001 PDB CREDO	0.502	0.315	0.502	0.011
Rv1207_2vp8_A	4	2ab2_SNL_B_503 PDB CREDO	0.502	0.315	0.502	0.011
Rv1207_2vp8_A	8	1v8b_ADN_D_3502 PDB CREDO	0.502	0.316	0.502	0.011
Rv1207_2vp8_A	4	2ab2_SNL_A_502 PDB CREDO	0.501	0.316	0.501	0.011
Rv1207_2vp8_A	4	3cs8_BRL_A_503 PDB CREDO	0.792	0.028	0.501	0.011
Rv1207_2vp8_A	4	2w8y_486_A_1000 PDB CREDO	0.566	0.222	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

DrugBank ID	Drug Name
DB00250DrugBank	Dapsone
DB00259DrugBank	Sulfanilamide
DB00263DrugBank	Sulfisoxazole
DB00576DrugBank	Sulfamethizole
DB00634DrugBank	Sulfacetamide
DB01015DrugBank	Sulfamethoxazole
DB01298DrugBank	Sulfacytine
DB01581DrugBank	Sulfamerazine
DB01582DrugBank	Sulfamethazine
DB06729DrugBank	Sulfaphenazole

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
6-hydroxymethyl-7,8-dihydropterinPubChem	0.974	195.179
p-aminobenzoic acidPubChem	0.968	137.136
pyrophosphatePubChem	0.949	177.975
dihydropteroatePubChem	0.949	314.299
phosphatePubChem	0.925	96.9872
7,8-dihydropterin pyrophosphatePubChem	0.923	355.138
dihydrofolatePubChem	0.921	443.413
adenosine monophosphatePubChem	0.901	347.221
adenosine diphosphatePubChem	0.9	427.201
H(+)PubChem	0.9	2.01588
pyruvic acidPubChem	0.9	88.0621
ethylene glycol; hydronPubChem	0.9	63.0758
glutamatePubChem	0.9	147.129
4-amino-4-deoxychorismatePubChem	0.9	225.198
polyethylene glycolPubChem	0.9	62.0678
protiumPubChem	0.9	2.01576
adenosine triphosphatePubChem	0.9	507.181
(3R)-4-ammonio-3-(1-carboxylatovinyloxy)cyclohexa-1,5-diene-1-carboxylatePubChem	0.9	224.19
deuteriumPubChem	0.9	2.01588