SInCRe - Rv0773c

Tuberculist information

Gene name	ggtA
Protein function	Probable bifunctional acylase GgtA: cephalosporin acylase (GL-7ACA acylase) + gamma-glutamyltranspeptidase (GGT)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	865.851
Molecular mass(da)	54592.9
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 512

	  		  	1    MPILATNVVCTSQPLAAQAGLRMLADGGNAVDAAVATAITLTVVEPVSNGIGSDAFSIVW   60
			  	61   DGQKLHGLNASGRSPSAWTPEYFGGNAVPVLGWNSVTVPGAVSAWVELHARFGRLPFETL  120
			  	121  FEPAISYGRNGFLVSPTVAAQWAAQVPLFASQPGFADAFMPGGRAPKPGELFTFPDHAAT  180
			  	181  LEKIAATNGEEFYRGELAAKLEAHSAANGGVMRADDLAAHRVDWVDTITGTYRGYTIHQI  240
			  	241  PPNGQGIVALIALGILEHFDMSSWSVDSAESVHVQIEALKLAFADAQACVADIDYMPVHP  300
			  	301  KRLLDKEYLRQRATLIDPKRAMPAATGIPRGGTVYLAAADAAGMMVSMIQSNYLGFGSGV  360
			  	361  VVPGTGISLHNRGSDFTVVPRHPNRVGPRKRPYHTIIPGFVTRDGAPVMSFGVMGGMMQP  420
			  	421  QGHVQVLVRIADYGQNPQAACDGPRFRWVNGMRVSFENGFPDSTLDELRQRGHDLVAVAD  480
			  	481  YSQFGSCQAIWRLDDGYLAASDPRRDGQAAAC

Known structures in the PDB

No Known structures

Number of amino acids : 512

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
G_glu_transpept	PF01019	21-507

Mtb Structural Proteome models

Model Number	1
Model name	Rv0773c
Template	2DG5 APDB CREDO
Template coverage	50_376
Template Identity(%)	29.6
Model coverage(%)	61.9
Normalized DOPE score	0.122

Model Number	2
Model name	Rv0773c.2
Template	2DG5 BPDB CREDO
Template coverage	391_578
Template Identity(%)	33.7
Model coverage(%)	34.6
Normalized DOPE score	0.513

Structure Models from Chopin

Model Number	1
Profile	d.153.1.6 Click for model details
zscore	82.68
Residue begin	1
Residue end	512

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0773c	Gene name	Confidence Score
Rv1848	ureA	0.956
Rv2213	pepB	0.932
Rv2213	pepB	0.932
Rv2855	mtr	0.929
Rv2855	mtr	0.929
Rv2855	mtr	0.929
Rv0266c	oplA	0.922
Rv0266c	oplA	0.922
Rv0266c	oplA	0.922
Rv3406	Rv3406	0.912
Rv3313c	add	0.911
Rv3432c	gadB	0.903

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0773c.2	11	3c9j_308_B_101 PDB CREDO	0.608	0.169	0.608	0.002
Rv0773c.2	11	1e7b_HLT_A_4003 PDB CREDO	0.576	0.208	0.576	0.003
Rv0773c.2	11	1e7b_HLT_B_4003 PDB CREDO	0.574	0.212	0.574	0.003
Rv0773c.2	11	2wd9_IBP_B_1570 PDB CREDO	0.571	0.215	0.571	0.004
Rv0773c.2	4	3aod_RFP_C_2002 PDB CREDO	0.662	0.113	0.555	0.005
Rv0773c.2	4	3jwq_VIA_D_901 PDB CREDO	0.574	0.212	0.555	0.005
Rv0773c.2	10	1ere_EST_E_600 PDB CREDO	0.635	0.139	0.551	0.005
Rv0773c.2	11	2wd9_IBP_A_1570 PDB CREDO	0.672	0.104	0.550	0.005
Rv0773c.2	10	1yi4_ADN_A_306 PDB CREDO	0.637	0.137	0.546	0.005
Rv0773c.2	10	1ere_EST_A_600 PDB CREDO	0.627	0.148	0.543	0.006
Rv0773c.2	10	1ere_EST_B_600 PDB CREDO	0.627	0.148	0.543	0.006
Rv0773c.2	10	2y7j_B49_C_1294 PDB CREDO	0.541	0.256	0.541	0.006
Rv0773c.2	4	2h42_VIA_B_902 PDB CREDO	0.621	0.154	0.541	0.006
Rv0773c.2	10	1gwr_EST_B_600 PDB CREDO	0.620	0.156	0.537	0.006
Rv0773c.2	10	1pcg_EST_B_2 PDB CREDO	0.620	0.156	0.537	0.006
Rv0773c.2	10	3tmz_06X_A_504 PDB CREDO	0.535	0.265	0.535	0.006
Rv0773c.2	10	1gwr_EST_A_600 PDB CREDO	0.617	0.159	0.535	0.006
Rv0773c.2	10	1qku_EST_A_600 PDB CREDO	0.616	0.161	0.534	0.006
Rv0773c.2	10	1qku_EST_B_600 PDB CREDO	0.616	0.161	0.534	0.006
Rv0773c.2	11	3re0_CPT_B_201 PDB CREDO	0.571	0.215	0.533	0.007
Rv0773c.2	10	1qku_EST_C_600 PDB CREDO	0.613	0.163	0.532	0.007
Rv0773c.2	10	2y7j_B49_A_1294 PDB CREDO	0.613	0.163	0.532	0.007
Rv0773c.2	10	2y7j_B49_D_1294 PDB CREDO	0.641	0.133	0.531	0.007
Rv0773c.2	4	3frq_ERY_B_195 PDB CREDO	0.605	0.173	0.531	0.007
Rv0773c.2	10	1g50_EST_B_1600 PDB CREDO	0.612	0.165	0.531	0.007
Rv0773c.2	4	4eb6_VLB_C_503 PDB CREDO	0.610	0.168	0.531	0.007
Rv0773c.2	4	2aa5_STR_B_302 PDB CREDO	0.548	0.247	0.530	0.007
Rv0773c.2	10	1cqp_803_A_311 PDB CREDO	0.611	0.166	0.530	0.007
Rv0773c.2	4	2aa5_STR_A_301 PDB CREDO	0.547	0.248	0.530	0.007
Rv0773c.2	10	1pg2_ADN_A_552 PDB CREDO	0.579	0.205	0.526	0.007
Rv0773c.2	4	1p93_DEX_A_1999 PDB CREDO	0.543	0.254	0.525	0.007
Rv0773c.2	4	1zgy_BRL_A_503 PDB CREDO	0.525	0.280	0.525	0.007
Rv0773c.2	4	1cil_ETS_A_263 PDB CREDO	0.541	0.257	0.523	0.008
Rv0773c.2	4	2h42_VIA_A_901 PDB CREDO	0.539	0.259	0.521	0.008
Rv0773c.2	4	1lhv_NOG_A_301 PDB CREDO	0.574	0.211	0.520	0.008
Rv0773c.2	11	3eor_CFV_A_901 PDB CREDO	0.649	0.125	0.520	0.008
Rv0773c.2	4	1p93_DEX_B_2999 PDB CREDO	0.537	0.262	0.519	0.008
Rv0773c.2	11	3re0_CPT_C_201 PDB CREDO	0.517	0.292	0.517	0.008
Rv0773c.2	4	1z2b_VLB_C_800 PDB CREDO	0.645	0.129	0.517	0.008
Rv0773c.2	4	2aax_PDN_A_502 PDB CREDO	0.533	0.268	0.516	0.009
Rv0773c.2	4	3jwq_VIA_B_901 PDB CREDO	0.592	0.188	0.515	0.009
Rv0773c.2	4	4eyb_0WO_A_303 PDB CREDO	0.571	0.216	0.515	0.009
Rv0773c.2	10	1gse_EAA_B_224 PDB CREDO	0.541	0.257	0.515	0.009
Rv0773c.2	4	3d91_REM_A_350 PDB CREDO	0.662	0.113	0.514	0.009
Rv0773c.2	4	2aa6_STR_B_402 PDB CREDO	0.532	0.270	0.514	0.009
Rv0773c.2	4	1nhz_486_A_800 PDB CREDO	0.514	0.297	0.514	0.009
Rv0773c.2	10	3hm1_J3Z_A_2 PDB CREDO	0.591	0.189	0.513	0.009
Rv0773c.2	4	2aax_PDN_B_503 PDB CREDO	0.530	0.273	0.513	0.009
Rv0773c.2	4	2aa6_STR_A_401 PDB CREDO	0.529	0.274	0.511	0.009
Rv0773c.2	4	2a69_RPT_M_8002 PDB CREDO	0.511	0.301	0.511	0.009
Rv0773c.2	4	2x9g_LYA_B_1270 PDB CREDO	0.511	0.301	0.511	0.009
Rv0773c.2	10	1gse_EAA_A_224 PDB CREDO	0.537	0.262	0.511	0.009
Rv0773c.2	10	3f8f_DM1_A_127 PDB CREDO	0.629	0.146	0.511	0.009
Rv0773c.2	4	3ln1_CEL_D_682 PDB CREDO	0.528	0.276	0.510	0.009
Rv0773c.2	10	1cqp_803_B_311 PDB CREDO	0.585	0.197	0.507	0.010
Rv0773c.2	10	3fl9_TOP_H_200 PDB CREDO	0.533	0.268	0.507	0.010
Rv0773c.2	4	3gn8_DEX_B_247 PDB CREDO	0.542	0.256	0.507	0.010
Rv0773c.2	4	2q1v_PDN_A_248 PDB CREDO	0.543	0.254	0.507	0.010
Rv0773c.2	4	1m2z_DEX_A_301 PDB CREDO	0.541	0.256	0.507	0.010
Rv0773c.2	4	1p93_DEX_C_3999 PDB CREDO	0.541	0.257	0.506	0.010
Rv0773c.2	4	3mne_DEX_A_784 PDB CREDO	0.541	0.257	0.506	0.010
Rv0773c.2	4	1ya3_STR_B_2001 PDB CREDO	0.541	0.257	0.505	0.010
Rv0773c.2	4	3gn8_DEX_A_247 PDB CREDO	0.540	0.259	0.505	0.010
Rv0773c.2	4	1uwh_BAX_B_1723 PDB CREDO	0.611	0.166	0.504	0.010
Rv0773c.2	4	3d91_REM_B_350 PDB CREDO	0.649	0.125	0.504	0.010
Rv0773c.2	4	3tne_RIT_A_401 PDB CREDO	0.574	0.211	0.504	0.010
Rv0773c.2	4	1uwh_BAX_A_1723 PDB CREDO	0.611	0.166	0.504	0.010
Rv0773c.2	4	3nrr_D16_B_520 PDB CREDO	0.540	0.259	0.504	0.010
Rv0773c.2	4	1m2z_DEX_D_401 PDB CREDO	0.537	0.262	0.503	0.010
Rv0773c.2	11	2xfh_CL6_A_1414 PDB CREDO	0.502	0.315	0.502	0.011
Rv0773c.2	4	1fm6_BRL_X_504 PDB CREDO	0.552	0.241	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
glutamatePubChem	0.982	147.129
Cys-GlyPubChem	0.936	178.21
cysteinylglycinePubChem	0.929	178.21
reduced glutathionePubChem	0.918	307.323
taurinePubChem	0.9	125.147
acivicinPubChem	0.867	178.574
SeMetPubChem	0.753	196.106
selenomethioninePubChem	0.753	196.106