SInCRe - Rv0014c

Tuberculist information

Gene name	pknB
Protein function	Transmembrane serine/threonine-protein kinase B PknB (protein kinase B) (STPK B)
Functional category(tuberculist)	regulatory proteins
Gene location(kb)	15.59
Molecular mass(da)	66509.8
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 626

	  		  	1    MTTPSHLSDRYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRADLARDPSFYLRFRREA   60
			  	61   QNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIA  120
			  	121  DACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAIADSGNSVTQTAAVIGTA  180
			  	181  QYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPPSARH  240
			  	241  EGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEPPEAPKVLTDAERTSLLSSA  300
			  	301  AGNLSGPRTDPLPRQDLDDTDRDRSIGSVGRWVAVVAVLAVLTVVVTIAINTFGGITRDV  360
			  	361  QVPDVRGQSSADAIATLQNRGFKIRTLQKPDSTIPPDHVIGTDPAANTSVSAGDEITVNV  420
			  	421  STGPEQREIPDVSTLTYAEAVKKLTAAGFGRFKQANSPSTPELVGKVIGTNPPANQTSAI  480
			  	481  TNVVIIIVGSGPATKDIPDVAGQTVDVAQKNLNVYGFTKFSQASVDSPRPAGEVTGTNPP  540
			  	541  AGTTVPVDSVIELQVSKGNQFVMPDLSGMFWVDAEPRLRALGWTGMLDKGADVDAGGSQH  600
			  	601  NRVVYQNPPAGTGVNRDGIITLRFGQ

Known structures in the PDB

	PDB ID	1MRU
	Total residue count	622
	Number of chains	2
	Method	X-RAY
	Resolution	3

	PDB ID	1O6Y
	Total residue count	299
	Number of chains	1
	Method	X-RAY
	Resolution	2.2

	PDB ID	2FUM
	Total residue count	1196
	Number of chains	4
	Method	X-RAY
	Resolution	2.89

	PDB ID	2KUD
	Total residue count	140
	Number of chains	1
	Method	NMR
	Resolution	N/A

	PDB ID	2KUE
	Total residue count	138
	Number of chains	1
	Method	NMR
	Resolution	N/A

	PDB ID	2KUF
	Total residue count	139
	Number of chains	1
	Method	NMR
	Resolution	N/A

	PDB ID	2KUI
	Total residue count	275
	Number of chains	1
	Method	NMR
	Resolution	N/A

	PDB ID	3F61
	Total residue count	311
	Number of chains	1
	Method	X-RAY
	Resolution	1.8

	PDB ID	3F69
	Total residue count	622
	Number of chains	2
	Method	X-RAY
	Resolution	2.8

	PDB ID	3ORI
	Total residue count	1244
	Number of chains	4
	Method	X-RAY
	Resolution	2

	PDB ID	3ORK
	Total residue count	311
	Number of chains	1
	Method	X-RAY
	Resolution	1.6

	PDB ID	3ORL
	Total residue count	311
	Number of chains	1
	Method	X-RAY
	Resolution	2.9

	PDB ID	3ORM
	Total residue count	311
	Number of chains	1
	Method	X-RAY
	Resolution	2.5

	PDB ID	3ORO
	Total residue count	311
	Number of chains	1
	Method	X-RAY
	Resolution	1.9

	PDB ID	3ORP
	Total residue count	311
	Number of chains	1
	Method	X-RAY
	Resolution	2.1

	PDB ID	3ORT
	Total residue count	311
	Number of chains	1
	Method	X-RAY
	Resolution	1.9

	PDB ID	3OUV
	Total residue count	71
	Number of chains	1
	Method	X-RAY
	Resolution	2

Number of amino acids : 626

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Pkinase	PF00069	11-274
PASTA	PF03793	360-422
PASTA	PF03793	427-490
PASTA	PF03793	495-557
PASTA	PF03793	561-626

Mtb Structural Proteome models

Model Number	1
Model name	Rv0014c
Template	1O6Y APDB CREDO
Template coverage	3_279
Template Identity(%)	99.6
Model coverage(%)	44.1
Normalized DOPE score	-0.722

Model Number	2
Model name	Rv0014c.3
Template	1B4F APDB CREDO
Template coverage	10_77
Template Identity(%)	11.8
Model coverage(%)	11.0
Normalized DOPE score	-0.451

Model Number	3
Model name	Rv0014c.2
Template	1Y8G APDB CREDO
Template coverage	49_362
Template Identity(%)	26.6
Model coverage(%)	53.8
Normalized DOPE score	-0.262

Structure Models from Chopin

Model Number	1
Profile	d.144.1.7 Click for model details
zscore	28.08
Residue begin	11
Residue end	274

Model Number	2
Profile	d.11.1.1 Click for model details
zscore	6.19
Residue begin	360
Residue end	424

Model Number	3
Profile	d.11.1.1 Click for model details
zscore	6.19
Residue begin	427
Residue end	491

Model Number	4
Profile	d.11.1.1 Click for model details
zscore	6.19
Residue begin	495
Residue end	559

Model Number	5
Profile	d.11.1.1 Click for model details
zscore	6.19
Residue begin	561
Residue end	625

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0014c	Gene name	Confidence Score
Rv0018c	pstP	0.998
Rv0016c	pbpA	0.996
Rv0017c	rodA	0.982
Rv0020c	fhaA	0.978
Rv0020c	fhaA	0.978
Rv1827	garA	0.972
Rv0019c	fhaB	0.946
Rv1018c	glmU	0.908
Rv1018c	glmU	0.908
Rv0015c	pknA	0.908

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0014c.2	8	3bbt_FMM_D_91 PDB CREDO	0.705	0.077	0.682	0.000
Rv0014c.2	10	1jg2_ADN_A_500 PDB CREDO	0.672	0.104	0.672	0.000
Rv0014c.2	10	3oht_1N1_B_1000 PDB CREDO	0.671	0.105	0.648	0.001
Rv0014c.2	8	1nhz_486_A_800 PDB CREDO	0.644	0.130	0.644	0.001
Rv0014c.2	10	3spk_TPV_A_100 PDB CREDO	0.685	0.092	0.640	0.001
Rv0014c.2	10	1jg3_ADN_A_500 PDB CREDO	0.704	0.078	0.632	0.001
Rv0014c.2	8	1mx1_THA_C_3 PDB CREDO	0.698	0.082	0.629	0.001
Rv0014c.2	8	2h42_VIA_A_901 PDB CREDO	0.649	0.125	0.628	0.001
Rv0014c.2	8	1p93_DEX_C_3999 PDB CREDO	0.668	0.107	0.626	0.001
Rv0014c.2	8	1p93_DEX_B_2999 PDB CREDO	0.647	0.127	0.625	0.001
Rv0014c.2	8	1p93_DEX_D_4999 PDB CREDO	0.668	0.108	0.625	0.001
Rv0014c.2	8	1m2z_DEX_A_301 PDB CREDO	0.667	0.108	0.625	0.001
Rv0014c.2	8	3gn8_DEX_A_247 PDB CREDO	0.667	0.108	0.625	0.001
Rv0014c.2	8	3mne_DEX_A_784 PDB CREDO	0.667	0.108	0.625	0.001
Rv0014c.2	8	3gn8_DEX_B_247 PDB CREDO	0.667	0.109	0.624	0.001
Rv0014c.2	8	1m2z_DEX_D_401 PDB CREDO	0.666	0.109	0.623	0.001
Rv0014c.2	8	1p93_DEX_A_1999 PDB CREDO	0.642	0.132	0.621	0.001
Rv0014c.2	8	2aax_PDN_B_503 PDB CREDO	0.641	0.133	0.620	0.001
Rv0014c.2	10	2ito_IRE_A_2020 PDB CREDO	0.744	0.051	0.620	0.001
Rv0014c.2	10	3oht_1N1_A_1000 PDB CREDO	0.716	0.069	0.619	0.001
Rv0014c.2	8	2aa6_STR_A_401 PDB CREDO	0.640	0.135	0.619	0.001
Rv0014c.2	8	2aax_PDN_A_502 PDB CREDO	0.640	0.135	0.619	0.001
Rv0014c.2	8	2aa6_STR_B_402 PDB CREDO	0.639	0.136	0.618	0.001
Rv0014c.2	8	1ya3_STR_A_1001 PDB CREDO	0.661	0.114	0.617	0.002
Rv0014c.2	8	1ya3_STR_B_2001 PDB CREDO	0.659	0.115	0.616	0.002
Rv0014c.2	10	3bbt_FMM_D_91 PDB CREDO	0.636	0.139	0.614	0.002
Rv0014c.2	8	3h0a_9RA_A_500 PDB CREDO	0.634	0.141	0.613	0.002
Rv0014c.2	8	3spk_TPV_A_100 PDB CREDO	0.612	0.164	0.612	0.002
Rv0014c.2	8	2q1v_PDN_A_248 PDB CREDO	0.655	0.119	0.612	0.002
Rv0014c.2	8	1jg2_ADN_A_500 PDB CREDO	0.653	0.121	0.610	0.002
Rv0014c.2	8	1a28_STR_B_2 PDB CREDO	0.672	0.104	0.609	0.002
Rv0014c.2	10	2fum_MIX_D_3539 PDB CREDO	0.629	0.146	0.608	0.002
Rv0014c.2	8	3h52_486_D_2 PDB CREDO	0.736	0.056	0.607	0.002
Rv0014c.2	8	1zgy_BRL_A_503 PDB CREDO	0.606	0.172	0.606	0.002
Rv0014c.2	8	3jwq_VIA_D_901 PDB CREDO	0.621	0.155	0.600	0.002
Rv0014c.2	8	3h52_486_A_3 PDB CREDO	0.725	0.063	0.599	0.002
Rv0014c.2	8	2aa5_STR_B_302 PDB CREDO	0.619	0.157	0.598	0.002
Rv0014c.2	1	3n58_ADN_A_500 PDB CREDO	0.618	0.158	0.596	0.002
Rv0014c.2	8	2aa5_STR_A_301 PDB CREDO	0.616	0.160	0.596	0.002
Rv0014c.2	8	3d90_NOG_B_2001 PDB CREDO	0.596	0.184	0.596	0.002
Rv0014c.2	8	3d90_NOG_A_1001 PDB CREDO	0.595	0.185	0.595	0.002
Rv0014c.2	8	3h52_486_C_4 PDB CREDO	0.682	0.095	0.593	0.002
Rv0014c.2	8	3rif_IVM_A_402 PDB CREDO	0.682	0.095	0.593	0.002
Rv0014c.2	8	3rif_IVM_B_403 PDB CREDO	0.681	0.096	0.593	0.002
Rv0014c.2	8	3rif_IVM_D_402 PDB CREDO	0.681	0.096	0.593	0.002
Rv0014c.2	8	3h52_486_B_1 PDB CREDO	0.738	0.055	0.591	0.002
Rv0014c.2	8	1a28_STR_A_1 PDB CREDO	0.655	0.120	0.590	0.003
Rv0014c.2	8	1lhv_NOG_A_301 PDB CREDO	0.650	0.125	0.589	0.003
Rv0014c.2	8	2fum_MIX_D_3539 PDB CREDO	0.608	0.169	0.588	0.003
Rv0014c.2	8	2h77_T3_A_1 PDB CREDO	0.588	0.193	0.588	0.003
Rv0014c.2	8	3ri5_IVM_C_350 PDB CREDO	0.676	0.100	0.588	0.003
Rv0014c.2	8	3ria_IVM_C_349 PDB CREDO	0.675	0.101	0.588	0.003
Rv0014c.2	10	2ity_IRE_A_2020 PDB CREDO	0.762	0.042	0.587	0.003
Rv0014c.2	8	3bbt_FMM_B_91 PDB CREDO	0.751	0.047	0.585	0.003
Rv0014c.2	8	1s9p_DES_A_459 PDB CREDO	0.648	0.127	0.584	0.003
Rv0014c.2	8	2h79_T3_A_1 PDB CREDO	0.602	0.176	0.583	0.003
Rv0014c.2	8	3rif_IVM_A_403 PDB CREDO	0.669	0.106	0.582	0.003
Rv0014c.2	10	1jg3_ADN_B_550 PDB CREDO	0.725	0.063	0.581	0.003
Rv0014c.2	10	2y6o_1N1_A_1892 PDB CREDO	0.687	0.091	0.581	0.003
Rv0014c.2	8	1sqn_NDR_B_2001 PDB CREDO	0.642	0.133	0.579	0.003
Rv0014c.2	8	2ab2_SNL_B_503 PDB CREDO	0.659	0.116	0.578	0.003
Rv0014c.2	8	3mno_DEX_A_784 PDB CREDO	0.679	0.098	0.578	0.003
Rv0014c.2	10	3k54_1N1_A_1 PDB CREDO	0.643	0.131	0.578	0.003
Rv0014c.2	8	1sqn_NDR_A_1001 PDB CREDO	0.640	0.134	0.577	0.003
Rv0014c.2	8	3mnp_DEX_A_784 PDB CREDO	0.678	0.099	0.577	0.003
Rv0014c.2	8	2ab2_SNL_A_502 PDB CREDO	0.656	0.119	0.576	0.003
Rv0014c.2	8	2oax_SNL_B_2001 PDB CREDO	0.655	0.119	0.575	0.003
Rv0014c.2	8	2oax_SNL_C_3001 PDB CREDO	0.655	0.119	0.575	0.003
Rv0014c.2	8	2h42_VIA_C_903 PDB CREDO	0.661	0.114	0.575	0.003
Rv0014c.2	8	3vhu_SNL_A_1001 PDB CREDO	0.654	0.120	0.574	0.003
Rv0014c.2	8	3gws_T3_X_500 PDB CREDO	0.614	0.163	0.574	0.003
Rv0014c.2	8	1mx1_THA_E_5 PDB CREDO	0.684	0.093	0.574	0.003
Rv0014c.2	3	1ie4_T44_A_128 PDB CREDO	0.597	0.183	0.573	0.003
Rv0014c.2	10	3rif_IVM_A_403 PDB CREDO	0.614	0.162	0.572	0.003
Rv0014c.2	8	1xzx_T3_X_500 PDB CREDO	0.631	0.144	0.572	0.003
Rv0014c.2	1	1d4f_ADN_C_603 PDB CREDO	0.592	0.189	0.572	0.003
Rv0014c.2	8	1bsx_T3_A_1 PDB CREDO	0.611	0.166	0.572	0.003
Rv0014c.2	8	1bsx_T3_B_2 PDB CREDO	0.611	0.166	0.572	0.003
Rv0014c.2	8	1jg3_ADN_A_500 PDB CREDO	0.681	0.096	0.571	0.004
Rv0014c.2	8	3uvv_T3_A_501 PDB CREDO	0.628	0.147	0.569	0.004
Rv0014c.2	10	1s9p_DES_A_459 PDB CREDO	0.590	0.192	0.569	0.004
Rv0014c.2	10	2itz_IRE_A_2021 PDB CREDO	0.767	0.039	0.568	0.004
Rv0014c.2	8	2w8y_486_A_1000 PDB CREDO	0.731	0.059	0.568	0.004
Rv0014c.2	8	3oct_1N1_A_663 PDB CREDO	0.607	0.170	0.567	0.004
Rv0014c.2	10	2fum_MIX_A_539 PDB CREDO	0.608	0.170	0.566	0.004
Rv0014c.2	10	3rif_IVM_A_402 PDB CREDO	0.608	0.170	0.566	0.004
Rv0014c.2	10	3rif_IVM_B_403 PDB CREDO	0.608	0.170	0.566	0.004
Rv0014c.2	10	3ri5_IVM_C_350 PDB CREDO	0.606	0.171	0.565	0.004
Rv0014c.2	10	3ria_IVM_C_349 PDB CREDO	0.606	0.171	0.565	0.004
Rv0014c.2	8	1fm6_BRL_D_503 PDB CREDO	0.627	0.149	0.565	0.004
Rv0014c.2	10	3rif_IVM_D_402 PDB CREDO	0.606	0.172	0.564	0.004
Rv0014c.2	8	1fm6_BRL_X_504 PDB CREDO	0.621	0.155	0.563	0.004
Rv0014c.2	8	1ya3_STR_C_3001 PDB CREDO	0.669	0.106	0.562	0.004
Rv0014c.2	8	3ln1_CEL_D_682 PDB CREDO	0.581	0.203	0.562	0.004
Rv0014c.2	10	3qlg_1N1_B_601 PDB CREDO	0.700	0.081	0.561	0.004
Rv0014c.2	3	1v8b_ADN_C_2502 PDB CREDO	0.584	0.199	0.561	0.004
Rv0014c.2	8	2h42_VIA_B_902 PDB CREDO	0.644	0.130	0.560	0.004
Rv0014c.2	10	3bbt_FMM_B_91 PDB CREDO	0.671	0.105	0.559	0.004
Rv0014c.2	10	3oct_1N1_A_663 PDB CREDO	0.559	0.232	0.559	0.004
Rv0014c.2	10	3qlg_1N1_A_601 PDB CREDO	0.697	0.083	0.559	0.004
Rv0014c.2	3	1d4f_ADN_A_601 PDB CREDO	0.581	0.202	0.558	0.004
Rv0014c.2	10	3g5d_1N1_B_1 PDB CREDO	0.696	0.084	0.558	0.004
Rv0014c.2	1	1hwi_115_C_4 PDB CREDO	0.557	0.234	0.557	0.004
Rv0014c.2	10	1mx1_THA_C_3 PDB CREDO	0.576	0.208	0.557	0.004
Rv0014c.2	8	1lhu_EST_A_301 PDB CREDO	0.617	0.159	0.556	0.004
Rv0014c.2	8	1s9p_DES_D_600 PDB CREDO	0.617	0.159	0.556	0.004
Rv0014c.2	8	3e22_LOC_B_700 PDB CREDO	0.633	0.141	0.556	0.005
Rv0014c.2	10	3g5d_1N1_A_1 PDB CREDO	0.693	0.086	0.556	0.005
Rv0014c.2	8	2prg_BRL_A_1 PDB CREDO	0.616	0.160	0.555	0.005
Rv0014c.2	8	1qkn_RAL_A_600 PDB CREDO	0.593	0.187	0.555	0.005
Rv0014c.2	8	3e22_LOC_D_700 PDB CREDO	0.632	0.143	0.555	0.005
Rv0014c.2	10	1ie4_T44_B_328 PDB CREDO	0.692	0.087	0.555	0.005
Rv0014c.2	8	2oax_SNL_D_4001 PDB CREDO	0.692	0.087	0.554	0.005
Rv0014c.2	8	2oax_SNL_E_5001 PDB CREDO	0.692	0.087	0.554	0.005
Rv0014c.2	8	2oax_SNL_F_6001 PDB CREDO	0.692	0.087	0.554	0.005
Rv0014c.2	3	2itz_IRE_A_2021 PDB CREDO	0.553	0.240	0.553	0.005
Rv0014c.2	8	2prg_BRL_B_2 PDB CREDO	0.613	0.164	0.553	0.005
Rv0014c.2	8	2oax_SNL_A_1001 PDB CREDO	0.690	0.089	0.552	0.005
Rv0014c.2	8	3qt0_486_A_4 PDB CREDO	0.571	0.215	0.552	0.005
Rv0014c.2	3	1v8b_ADN_D_3502 PDB CREDO	0.599	0.180	0.552	0.005
Rv0014c.2	8	1uwh_BAX_B_1723 PDB CREDO	0.668	0.107	0.552	0.005
Rv0014c.2	8	1uwh_BAX_A_1723 PDB CREDO	0.667	0.109	0.550	0.005
Rv0014c.2	8	2hw2_RFP_A_1200 PDB CREDO	0.627	0.149	0.550	0.005
Rv0014c.2	10	3v5w_8PR_A_701 PDB CREDO	0.629	0.146	0.550	0.005
Rv0014c.2	8	3erd_DES_A_600 PDB CREDO	0.631	0.144	0.549	0.005
Rv0014c.2	8	3ria_IVM_E_348 PDB CREDO	0.705	0.077	0.549	0.005
Rv0014c.2	8	3rif_IVM_E_402 PDB CREDO	0.705	0.077	0.549	0.005
Rv0014c.2	8	3ri5_IVM_B_349 PDB CREDO	0.705	0.077	0.549	0.005
Rv0014c.2	8	3ri5_IVM_D_349 PDB CREDO	0.705	0.077	0.549	0.005
Rv0014c.2	8	3ria_IVM_A_348 PDB CREDO	0.705	0.077	0.549	0.005
Rv0014c.2	8	3rhw_IVM_D_348 PDB CREDO	0.704	0.078	0.548	0.005
Rv0014c.2	8	2y6o_1N1_A_1892 PDB CREDO	0.605	0.174	0.548	0.005
Rv0014c.2	3	1ie4_T44_B_328 PDB CREDO	0.593	0.188	0.548	0.005
Rv0014c.2	1	3n58_ADN_D_500 PDB CREDO	0.632	0.142	0.547	0.005
Rv0014c.2	8	3rhw_IVM_B_349 PDB CREDO	0.703	0.078	0.547	0.005
Rv0014c.2	8	3rhw_IVM_D_349 PDB CREDO	0.703	0.078	0.547	0.005
Rv0014c.2	10	3ut5_LOC_D_502 PDB CREDO	0.667	0.108	0.547	0.005
Rv0014c.2	8	3rhw_IVM_B_348 PDB CREDO	0.702	0.079	0.547	0.005
Rv0014c.2	8	3ria_IVM_C_350 PDB CREDO	0.702	0.079	0.547	0.005
Rv0014c.2	1	3ce6_ADN_C_500 PDB CREDO	0.632	0.143	0.547	0.005
Rv0014c.2	3	1jg3_ADN_B_550 PDB CREDO	0.592	0.189	0.547	0.005
Rv0014c.2	8	1sa1_POD_D_701 PDB CREDO	0.682	0.095	0.546	0.005
Rv0014c.2	1	3ce6_ADN_D_500 PDB CREDO	0.630	0.145	0.546	0.005
Rv0014c.2	8	2fum_MIX_A_539 PDB CREDO	0.626	0.149	0.545	0.005
Rv0014c.2	1	3ce6_ADN_A_500 PDB CREDO	0.628	0.147	0.544	0.006
Rv0014c.2	8	3ri5_IVM_A_349 PDB CREDO	0.698	0.082	0.544	0.006
Rv0014c.2	8	3k54_1N1_A_1 PDB CREDO	0.647	0.127	0.543	0.006
Rv0014c.2	8	3jwq_VIA_B_901 PDB CREDO	0.623	0.152	0.542	0.006
Rv0014c.2	8	3oht_1N1_B_1000 PDB CREDO	0.602	0.177	0.542	0.006
Rv0014c.2	3	2ity_IRE_A_2020 PDB CREDO	0.563	0.226	0.541	0.006
Rv0014c.2	8	3erd_DES_B_800 PDB CREDO	0.621	0.154	0.541	0.006
Rv0014c.2	8	3ria_IVM_E_349 PDB CREDO	0.694	0.085	0.541	0.006
Rv0014c.2	8	3ut5_LOC_D_502 PDB CREDO	0.616	0.161	0.541	0.006
Rv0014c.2	8	3ln1_CEL_A_682 PDB CREDO	0.577	0.207	0.540	0.006
Rv0014c.2	3	3glq_RAB_B_602 PDB CREDO	0.562	0.227	0.540	0.006
Rv0014c.2	8	1err_RAL_A_600 PDB CREDO	0.635	0.140	0.540	0.006
Rv0014c.2	1	3ce6_ADN_B_500 PDB CREDO	0.624	0.151	0.540	0.006
Rv0014c.2	8	3rhw_IVM_A_348 PDB CREDO	0.694	0.086	0.540	0.006
Rv0014c.2	10	3ads_IMN_B_3 PDB CREDO	0.825	0.017	0.540	0.006
Rv0014c.2	3	3glq_RAB_A_602 PDB CREDO	0.562	0.228	0.540	0.006
Rv0014c.2	10	1sa1_POD_D_701 PDB CREDO	0.722	0.065	0.540	0.006
Rv0014c.2	8	3ln1_CEL_B_682 PDB CREDO	0.576	0.209	0.539	0.006
Rv0014c.2	8	3ln1_CEL_C_682 PDB CREDO	0.576	0.209	0.539	0.006
Rv0014c.2	10	2xkw_P1B_B_1475 PDB CREDO	0.579	0.206	0.539	0.006
Rv0014c.2	8	2xkw_P1B_B_1475 PDB CREDO	0.619	0.156	0.539	0.006
Rv0014c.2	8	3so9_017_A_100 PDB CREDO	0.653	0.121	0.539	0.006
Rv0014c.2	8	1gs4_ZK5_A_1918 PDB CREDO	0.619	0.157	0.538	0.006
Rv0014c.2	8	3frq_ERY_B_195 PDB CREDO	0.612	0.164	0.538	0.006
Rv0014c.2	3	1d4f_ADN_B_602 PDB CREDO	0.628	0.147	0.537	0.006
Rv0014c.2	10	2gqg_1N1_A_501 PDB CREDO	0.577	0.208	0.537	0.006
Rv0014c.2	10	3adx_IMN_B_3 PDB CREDO	0.725	0.063	0.537	0.006
Rv0014c.2	11	4eyb_0WO_A_303 PDB CREDO	0.537	0.263	0.537	0.006
Rv0014c.2	8	2jfa_RAL_B_600 PDB CREDO	0.631	0.144	0.537	0.006
Rv0014c.2	8	3d91_REM_A_350 PDB CREDO	0.690	0.089	0.536	0.006
Rv0014c.2	8	2jfa_RAL_A_600 PDB CREDO	0.610	0.167	0.536	0.006
Rv0014c.2	1	3g1u_ADN_C_438 PDB CREDO	0.618	0.158	0.535	0.006
Rv0014c.2	10	1ie4_T44_A_128 PDB CREDO	0.752	0.047	0.535	0.006
Rv0014c.2	10	3so9_017_A_100 PDB CREDO	0.694	0.086	0.535	0.006
Rv0014c.2	10	3rhw_IVM_A_348 PDB CREDO	0.641	0.134	0.534	0.006
Rv0014c.2	10	3ri5_IVM_A_349 PDB CREDO	0.641	0.134	0.534	0.006
Rv0014c.2	8	1err_RAL_B_600 PDB CREDO	0.628	0.147	0.534	0.006
Rv0014c.2	3	3r9c_ECL_A_452 PDB CREDO	0.580	0.204	0.534	0.006
Rv0014c.2	10	3ria_IVM_E_349 PDB CREDO	0.640	0.134	0.534	0.007
Rv0014c.2	3	3n58_ADN_C_500 PDB CREDO	0.555	0.237	0.533	0.007
Rv0014c.2	8	1y0x_T44_X_500 PDB CREDO	0.646	0.128	0.533	0.007
Rv0014c.2	8	3adx_IMN_B_3 PDB CREDO	0.771	0.037	0.533	0.007
Rv0014c.2	1	4e3a_ADN_B_500 PDB CREDO	0.616	0.161	0.533	0.007
Rv0014c.2	10	1d4f_ADN_C_603 PDB CREDO	0.552	0.241	0.533	0.007
Rv0014c.2	10	1sa1_POD_B_700 PDB CREDO	0.734	0.057	0.532	0.007
Rv0014c.2	10	3spk_TPV_B_100 PDB CREDO	0.756	0.045	0.532	0.007
Rv0014c.2	8	1mx1_THA_D_4 PDB CREDO	0.737	0.055	0.531	0.007
Rv0014c.2	3	1ict_T44_C_128 PDB CREDO	0.553	0.240	0.531	0.007
Rv0014c.2	3	1v8b_ADN_B_1502 PDB CREDO	0.576	0.209	0.531	0.007
Rv0014c.2	10	3tne_RIT_A_401 PDB CREDO	0.647	0.128	0.530	0.007
Rv0014c.2	10	1hwi_115_A_2 PDB CREDO	0.586	0.196	0.530	0.007
Rv0014c.2	8	3d91_REM_B_350 PDB CREDO	0.681	0.096	0.529	0.007
Rv0014c.2	8	1mx1_THA_F_6 PDB CREDO	0.735	0.057	0.529	0.007
Rv0014c.2	8	1sa1_POD_B_700 PDB CREDO	0.680	0.097	0.529	0.007
Rv0014c.2	3	1d4f_ADN_D_604 PDB CREDO	0.617	0.159	0.528	0.007
Rv0014c.2	10	3kw2_ADN_A_300 PDB CREDO	0.610	0.167	0.528	0.007
Rv0014c.2	8	1z2b_VLB_C_800 PDB CREDO	0.659	0.116	0.527	0.007
Rv0014c.2	10	3ri5_IVM_D_349 PDB CREDO	0.631	0.144	0.526	0.007
Rv0014c.2	8	1ya4_CTX_C_3 PDB CREDO	0.729	0.060	0.525	0.007
Rv0014c.2	10	3ut5_LOC_B_502 PDB CREDO	0.682	0.095	0.525	0.007
Rv0014c.2	10	3rhw_IVM_D_348 PDB CREDO	0.630	0.145	0.525	0.007
Rv0014c.2	10	3ria_IVM_A_348 PDB CREDO	0.630	0.145	0.525	0.007
Rv0014c.2	10	3rif_IVM_E_402 PDB CREDO	0.630	0.145	0.525	0.007
Rv0014c.2	1	1hwi_115_A_2 PDB CREDO	0.580	0.204	0.524	0.008
Rv0014c.2	10	1uwh_BAX_A_1723 PDB CREDO	0.679	0.098	0.524	0.008
Rv0014c.2	10	3rhw_IVM_B_348 PDB CREDO	0.628	0.147	0.523	0.008
Rv0014c.2	10	1uwh_BAX_B_1723 PDB CREDO	0.679	0.098	0.523	0.008
Rv0014c.2	10	3e22_LOC_B_700 PDB CREDO	0.638	0.137	0.523	0.008
Rv0014c.2	10	3rhw_IVM_B_349 PDB CREDO	0.627	0.148	0.523	0.008
Rv0014c.2	10	3ria_IVM_E_348 PDB CREDO	0.627	0.148	0.523	0.008
Rv0014c.2	8	3sxr_1N1_A_1 PDB CREDO	0.725	0.063	0.523	0.008
Rv0014c.2	10	2zva_1N1_A_513 PDB CREDO	0.677	0.100	0.522	0.008
Rv0014c.2	10	3ri5_IVM_B_349 PDB CREDO	0.626	0.149	0.522	0.008
Rv0014c.2	10	3ria_IVM_C_350 PDB CREDO	0.626	0.149	0.522	0.008
Rv0014c.2	8	2ito_IRE_A_2020 PDB CREDO	0.671	0.105	0.522	0.008
Rv0014c.2	1	1oq5_CEL_A_701 PDB CREDO	0.560	0.231	0.521	0.008
Rv0014c.2	10	1hwi_115_C_4 PDB CREDO	0.521	0.285	0.521	0.008
Rv0014c.2	10	3rhw_IVM_D_349 PDB CREDO	0.626	0.150	0.521	0.008
Rv0014c.2	8	1ya4_CTX_B_2 PDB CREDO	0.724	0.064	0.521	0.008
Rv0014c.2	11	4eb6_VLB_C_503 PDB CREDO	0.540	0.258	0.521	0.008
Rv0014c.2	3	3fuu_ADN_A_0 PDB CREDO	0.564	0.225	0.521	0.008
Rv0014c.2	8	1uwj_BAX_B_1723 PDB CREDO	0.671	0.105	0.521	0.008
Rv0014c.2	10	3e22_LOC_D_700 PDB CREDO	0.635	0.139	0.521	0.008
Rv0014c.2	8	2gqg_1N1_B_502 PDB CREDO	0.538	0.260	0.521	0.008
Rv0014c.2	8	3tkd_CYZ_B_267 PDB CREDO	0.631	0.144	0.520	0.008
Rv0014c.2	1	3g1u_ADN_D_438 PDB CREDO	0.624	0.151	0.520	0.008
Rv0014c.2	3	1uay_ADN_A_1001 PDB CREDO	0.672	0.104	0.519	0.008
Rv0014c.2	8	2gqg_1N1_A_501 PDB CREDO	0.595	0.184	0.518	0.008
Rv0014c.2	8	3spk_TPV_B_100 PDB CREDO	0.686	0.091	0.518	0.008
Rv0014c.2	10	1t7j_478_A_200 PDB CREDO	0.672	0.104	0.517	0.008
Rv0014c.2	3	1d4f_ADN_C_603 PDB CREDO	0.673	0.103	0.517	0.008
Rv0014c.2	8	1jg3_ADN_B_550 PDB CREDO	0.689	0.089	0.516	0.009
Rv0014c.2	8	3tne_RIT_A_401 PDB CREDO	0.588	0.193	0.516	0.009
Rv0014c.2	1	1ynn_RFP_C_1120 PDB CREDO	0.554	0.239	0.516	0.009
Rv0014c.2	10	3lfa_1N1_A_361 PDB CREDO	0.756	0.044	0.516	0.009
Rv0014c.2	3	3qlg_1N1_A_601 PDB CREDO	0.558	0.232	0.516	0.009
Rv0014c.2	3	3kw2_ADN_A_300 PDB CREDO	0.602	0.176	0.516	0.009
Rv0014c.2	10	1mx1_THA_E_5 PDB CREDO	0.574	0.212	0.515	0.009
Rv0014c.2	3	3g5d_1N1_B_1 PDB CREDO	0.558	0.234	0.515	0.009
Rv0014c.2	3	2uxo_TAC_B_1211 PDB CREDO	0.514	0.296	0.514	0.009
Rv0014c.2	3	4dta_ADN_A_401 PDB CREDO	0.636	0.138	0.514	0.009
Rv0014c.2	10	3sxr_1N1_A_1 PDB CREDO	0.667	0.109	0.514	0.009
Rv0014c.2	3	2ito_IRE_A_2020 PDB CREDO	0.578	0.206	0.514	0.009
Rv0014c.2	10	3erd_DES_B_800 PDB CREDO	0.551	0.242	0.514	0.009
Rv0014c.2	3	3qlg_1N1_B_601 PDB CREDO	0.556	0.236	0.514	0.009
Rv0014c.2	10	2uxo_TAC_B_1211 PDB CREDO	0.692	0.087	0.513	0.009
Rv0014c.2	1	3ond_ADN_A_506 PDB CREDO	0.664	0.111	0.512	0.009
Rv0014c.2	8	3vn2_TLS_A_501 PDB CREDO	0.602	0.177	0.512	0.009
Rv0014c.2	10	3hec_STI_A_1 PDB CREDO	0.624	0.151	0.512	0.009
Rv0014c.2	1	1d4f_ADN_D_604 PDB CREDO	0.591	0.190	0.512	0.009
Rv0014c.2	1	1v8b_ADN_C_2502 PDB CREDO	0.664	0.112	0.512	0.009
Rv0014c.2	3	3n58_ADN_D_500 PDB CREDO	0.598	0.182	0.512	0.009
Rv0014c.2	3	3kw2_ADN_B_300 PDB CREDO	0.532	0.269	0.511	0.009
Rv0014c.2	10	3kw2_ADN_B_300 PDB CREDO	0.663	0.112	0.511	0.009
Rv0014c.2	25	2bxg_IBP_A_2002 PDB CREDO	0.511	0.301	0.511	0.009
Rv0014c.2	10	3tne_RIT_B_401 PDB CREDO	0.623	0.152	0.511	0.009
Rv0014c.2	25	3hgx_SAL_A_102 PDB CREDO	0.571	0.215	0.511	0.009
Rv0014c.2	10	3oez_STI_B_601 PDB CREDO	0.623	0.153	0.510	0.009
Rv0014c.2	10	1m17_AQ4_A_999 PDB CREDO	0.717	0.069	0.510	0.009
Rv0014c.2	10	1s9p_DES_D_600 PDB CREDO	0.528	0.275	0.510	0.009
Rv0014c.2	3	3ce6_ADN_C_500 PDB CREDO	0.595	0.185	0.509	0.009
Rv0014c.2	8	3tkd_CYZ_A_266 PDB CREDO	0.580	0.203	0.509	0.009
Rv0014c.2	3	3g5d_1N1_A_1 PDB CREDO	0.551	0.243	0.509	0.009
Rv0014c.2	10	1lhv_NOG_A_301 PDB CREDO	0.601	0.178	0.508	0.010
Rv0014c.2	10	1lhu_EST_A_301 PDB CREDO	0.526	0.278	0.508	0.010
Rv0014c.2	3	3ce6_ADN_B_500 PDB CREDO	0.593	0.187	0.508	0.010
Rv0014c.2	3	3g1u_ADN_C_438 PDB CREDO	0.593	0.187	0.508	0.010
Rv0014c.2	25	2bxg_IBP_B_2002 PDB CREDO	0.508	0.307	0.508	0.010
Rv0014c.2	1	1d4f_ADN_B_602 PDB CREDO	0.586	0.196	0.508	0.010
Rv0014c.2	10	3f4x_KLT_A_300 PDB CREDO	0.609	0.169	0.508	0.010
Rv0014c.2	8	3ut5_LOC_B_502 PDB CREDO	0.614	0.162	0.507	0.010
Rv0014c.2	8	1uwj_BAX_A_1723 PDB CREDO	0.711	0.072	0.507	0.010
Rv0014c.2	10	1hwi_115_B_1 PDB CREDO	0.618	0.158	0.506	0.010
Rv0014c.2	8	3ri5_IVM_E_349 PDB CREDO	0.703	0.079	0.506	0.010
Rv0014c.2	1	2a69_RPT_C_8001 PDB CREDO	0.584	0.198	0.506	0.010
Rv0014c.2	8	3oez_STI_B_601 PDB CREDO	0.576	0.209	0.505	0.010
Rv0014c.2	3	3ce6_ADN_D_500 PDB CREDO	0.590	0.191	0.505	0.010
Rv0014c.2	11	3k2h_LYA_B_514 PDB CREDO	0.505	0.311	0.505	0.010
Rv0014c.2	11	4eyb_0WO_B_301 PDB CREDO	0.543	0.254	0.505	0.010
Rv0014c.2	3	3ce6_ADN_A_500 PDB CREDO	0.589	0.192	0.505	0.010
Rv0014c.2	1	1fr6_AZR_B_362 PDB CREDO	0.605	0.173	0.505	0.010
Rv0014c.2	10	1hwi_115_D_3 PDB CREDO	0.615	0.161	0.504	0.010
Rv0014c.2	8	4asd_BAX_A_1500 PDB CREDO	0.649	0.126	0.504	0.010
Rv0014c.2	1	2c49_ADN_A_1301 PDB CREDO	0.628	0.147	0.504	0.010
Rv0014c.2	3	2xn7_T44_A_1355 PDB CREDO	0.503	0.314	0.503	0.010
Rv0014c.2	8	2w8y_NDR_B_1000 PDB CREDO	0.698	0.082	0.503	0.010
Rv0014c.2	8	3oht_1N1_A_1000 PDB CREDO	0.622	0.154	0.503	0.010
Rv0014c.2	11	1d4f_ADN_C_603 PDB CREDO	0.503	0.314	0.503	0.011
Rv0014c.2	8	2pl0_STI_A_200 PDB CREDO	0.628	0.147	0.502	0.011
Rv0014c.2	3	1jg3_ADN_A_500 PDB CREDO	0.609	0.168	0.502	0.011
Rv0014c.2	8	3b0w_DGX_A_1 PDB CREDO	0.646	0.128	0.502	0.011
Rv0014c.2	1	1fr6_AZR_A_362 PDB CREDO	0.602	0.176	0.502	0.011
Rv0014c.2	3	1hwi_115_C_4 PDB CREDO	0.677	0.100	0.502	0.011
Rv0014c.2	3	3g1u_ADN_B_438 PDB CREDO	0.522	0.285	0.501	0.011
Rv0014c.2	3	3g1u_ADN_A_438 PDB CREDO	0.521	0.286	0.500	0.011
Rv0014c.2	10	1sn5_T3_C_601 PDB CREDO	0.733	0.058	0.500	0.011
Rv0014c.2	10	3jwq_VIA_D_901 PDB CREDO	0.518	0.291	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

View results in TIBLE page

Name	Affinity	Assay description	DOI
CHEMBL1170139	Inhibition = 98 %	Inhibition of Mycobacterium tuberculosis PKNB at 10 uM	http://www.ncbi.nlm.nih.gov/pubmed/20541934
CHEMBL1171523	Inhibition = 87 %	Inhibition of Mycobacterium tuberculosis PKNB at 10 uM	http://www.ncbi.nlm.nih.gov/pubmed/20541934
CHEMBL2017707	IC50 = 0.322 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017708	IC50 = 0.453 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017709	IC50 = 1.162 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017710	IC50 = 0.223 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017711	IC50 = 0.44 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017712	IC50 = 0.107 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017713	IC50 = 0.428 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017714	IC50 = 0.375 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017715	IC50 = 0.384 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017716	IC50 = 0.393 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017717	IC50 = 0.086 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017718	IC50 = 0.241 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017719	IC50 = 0.087 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017720	IC50 = 0.202 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017721	IC50 = 0.084 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017722	IC50 = 0.354 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017723	IC50 = 0.715 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017724	IC50 = 0.074 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017725	IC50 = 0.064 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017726	IC50 = 0.217 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017727	IC50 = 0.115 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017728	IC50 = 0.088 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017729	IC50 = 0.121 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017730	IC50 = 0.055 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017731	IC50 = 0.073 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017732	IC50 = 0.053 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017733	IC50 = 0.056 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017734	IC50 = 0.056 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017735	IC50 = 0.039 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017736	IC50 = 0.023 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017737	IC50 = 0.04 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017738	IC50 = 1.99 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017739	IC50 = 1.13 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017870	IC50 = 0.176 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017871	IC50 = 0.04 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL549536	IC50 = 1.35 uM	Inhibition of Mycobacterium tuberculosis GST-fused PknB expressed in Escherichia coli assessed as GarA substrate phosphorylation after 30 mins	http://www.ncbi.nlm.nih.gov/pubmed/22469702

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Target name	CHEMBL ID	SMILES
Plk1(PBD)	CC(C)C1=CC(=O)C(C)=CC1=O
Plk1(PBD)	CC(C)C1=CC(=N/O)C(C)=CC1=O

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
ATP analogPubChem	0.984	505.208
adenosine 5'-O-(3-thiotriphosphate)PubChem	0.979	523.247
mitoxantronePubChem	0.914	444.481
magnesiumPubChem	0.906	24.305
sulfatePubChem	0.904	96.0626
hydron sulfatePubChem	0.904	196.157
O-phospho-L-threoninePubChem	0.903	199.099
adenosine diphosphatePubChem	0.902	427.201
[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-hydroxPubChem	0.9	523.247
AMP-PCPPubChem	0.9	505.208
DB03909PubChem	0.8	505.208
DB02930PubChem	0.8	523.247