SInCRe - Rv3541c

Tuberculist information

Gene name	Rv3541c
Protein function	Conserved protein
Functional category(tuberculist)	conserved hypotheticals
Gene location(kb)	3980.66
Molecular mass(da)	13951.9
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 129

	  		  	1    MTVVGAVLPELKLYGDPTFIVSTALATRDFQDVHHDRDKAVAQGSKDIFVNILTDTGLVQ   60
			  	61   RYVTDWAGPSALIKSIGLRLGVPWYAYDTVTFSGEVTAVNDGLITVKVVGRNTLGDHVTA  120
			  	121  TVELSMRDS

Known structures in the PDB

No Known structures

Number of amino acids : 129

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
MaoC_dehydratas	PF01575	17-112

Mtb Structural Proteome models

Model Number	1
Model name	Rv3541c
Template	1IQ6 APDB CREDO
Template coverage	7_132
Template Identity(%)	18.7
Model coverage(%)	94.6
Normalized DOPE score	-0.322

Structure Models from Chopin

Model Number	1
Profile	d.38.1.4 - 3.10.129.10 Click for model details
zscore	12.02
Residue begin	1
Residue end	129

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3541c	Gene name	Confidence Score
Rv3542c	Rv3542c	0.998
Rv3542c	Rv3542c	0.998
Rv3540c	ltp2	0.996
Rv3540c	ltp2	0.996
Rv3543c	fadE29	0.989
Rv3543c	fadE29	0.989
Rv3543c	fadE29	0.989
Rv3544c	fadE28	0.959
Rv3544c	fadE28	0.959
Rv3545c	cyp125	0.948

Potential ligand/drug binding sites

No binding sites identified

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions