SInCRe - Rv3418c

Tuberculist information

Gene name	groES
Protein function	10 kDa chaperonin GroES (protein CPN10) (protein GroES) (BCG-a heat shock protein) (10 kDa antigen)
Functional category(tuberculist)	virulence,detoxification and adaptaion
Gene location(kb)	3836.99
Molecular mass(da)	10772.2
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 100

	  		  	1    VAKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIP   60
			  	61   LDVAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK

Known structures in the PDB

Number of amino acids : 100

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Cpn10	PF00166	5-98

Mtb Structural Proteome models

Structure Models from Chopin

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3418c	Gene name	Confidence Score
Rv3417c	groEL1	0.999
Rv0440	groEL2	0.999
Rv0350	dnaK	0.995
Rv2299c	htpG	0.969
Rv2299c	htpG	0.969
Rv1617	pykA	0.94
Rv1617	pykA	0.94
Rv0351	grpE	0.926

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3418c_1p3h_A	1	1d4f_ADN_B_602 PDB CREDO	0.573	0.213	0.573	0.003
Rv3418c_1p3h_A	1	1d4f_ADN_D_604 PDB CREDO	0.572	0.214	0.572	0.003
Rv3418c_1p3h_A	1	1d4f_ADN_C_603 PDB CREDO	0.604	0.174	0.541	0.006
Rv3418c_1p3h_A	1	1d4f_ADN_A_601 PDB CREDO	0.585	0.197	0.521	0.008
Rv3418c_1p3h_A	1	2pgf_ADN_A_501 PDB CREDO	0.509	0.305	0.509	0.010
Rv3418c_1p3h_A	1	3tic_ZMR_C_1002 PDB CREDO	0.525	0.281	0.505	0.010
Rv3418c_1p3h_A	1	1nnc_ZMR_A_479 PDB CREDO	0.524	0.282	0.505	0.010
Rv3418c_1p3h_A	1	3tic_ZMR_A_1002 PDB CREDO	0.524	0.282	0.505	0.010
Rv3418c_1p3h_A	1	3tic_ZMR_B_1002 PDB CREDO	0.523	0.283	0.504	0.010
Rv3418c_1p3h_A	1	3tic_ZMR_D_1002 PDB CREDO	0.523	0.283	0.504	0.010

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
2-methyl-2,4-pentanediolPubChem	0.979	118.174
(4s)-2-Methyl-2,4-PentanediolPubChem	0.979	118.174
calciumPubChem	0.903	40.078
magnesiumPubChem	0.845	24.305
adenosine diphosphatePubChem	0.799	427.201
aluminum fluoridePubChem	0.708	83.9767
dimethyl sulphoxidePubChem	0.708	78.1334
potassiumPubChem	0.707	39.0983