SInCRe - Rv3286c

Tuberculist information

Gene name	sigF
Protein function	Alternative RNA polymerase sigma factor SigF
Functional category(tuberculist)	information pathways
Gene location(kb)	3668.17
Molecular mass(da)	28761.6
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 261

	  		  	1    VTARAAGGSASRANEYADVPEMFRELVGLPAGSPEFQRHRDKIVQRCLPLADHIARRFEG   60
			  	61   RGEPRDDLIQVARVGLVNAAVRFDVKTGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRL  120
			  	121  KELHLRLGTATADLSQRLGRAPSASELAAELGMDRAEVIEGLLAGSSYHTLSIDSGGGSD  180
			  	181  DDARAITDTLGDVDAGLDQIENREVLRPLLEALPERERTVLVLRFFDSMTQTQIAERVGI  240
			  	241  SQMHVSRLLAKSLARLRDQLE

Known structures in the PDB

No Known structures

Number of amino acids : 261

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Sigma70_r2	PF04542	43-113
Sigma70_r3	PF04539	122-195
Sigma70_r4	PF04545	209-258

Mtb Structural Proteome models

Model Number	1
Model name	Rv3286c
Template	1RP3 APDB CREDO
Template coverage	8_232
Template Identity(%)	27.7
Model coverage(%)	85.4
Normalized DOPE score	-0.706

Model Number	2
Model name	Rv3286c.1
Template	2A6H FPDB CREDO
Template coverage	147_413
Template Identity(%)	21.8
Model coverage(%)	99.6
Normalized DOPE score	1.018

Structure Models from Chopin

Model Number	1
Profile	a.4.13.1 Click for model details
zscore	11.39
Residue begin	113
Residue end	192

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3286c	Gene name	Confidence Score
Rv3287c	rsbW	0.994
Rv0667	rpoB	0.958
Rv0667	rpoB	0.958
Rv0667	rpoB	0.958
Rv0667	rpoB	0.958
Rv0667	rpoB	0.958
Rv0667	rpoB	0.958
Rv3223c	sigH	0.924
Rv3223c	sigH	0.924
Rv2069	sigC	0.918
Rv2069	sigC	0.918
Rv0735	sigL	0.911
Rv0735	sigL	0.911

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3286c.1	6	1t46_STI_A_3 PDB CREDO	0.653	0.121	0.619	0.001
Rv3286c.1	6	1xkk_FMM_A_91 PDB CREDO	0.669	0.107	0.602	0.002
Rv3286c.1	6	1uwj_BAX_A_1723 PDB CREDO	0.653	0.121	0.601	0.002
Rv3286c.1	6	2qxs_RAL_A_600 PDB CREDO	0.590	0.191	0.590	0.003
Rv3286c.1	6	2qxs_RAL_B_600 PDB CREDO	0.590	0.191	0.590	0.003
Rv3286c.1	6	3b0w_DGX_B_1 PDB CREDO	0.617	0.159	0.584	0.003
Rv3286c.1	6	1opj_STI_A_3 PDB CREDO	0.592	0.189	0.576	0.003
Rv3286c.1	6	4asd_BAX_A_1500 PDB CREDO	0.683	0.094	0.576	0.003
Rv3286c.1	6	1opj_STI_B_4 PDB CREDO	0.589	0.193	0.573	0.003
Rv3286c.1	6	3bjw_SVR_E_503 PDB CREDO	0.586	0.197	0.570	0.004
Rv3286c.1	6	3cs9_NIL_A_600 PDB CREDO	0.584	0.198	0.569	0.004
Rv3286c.1	6	3cs9_NIL_B_600 PDB CREDO	0.569	0.219	0.569	0.004
Rv3286c.1	6	2xkw_P1B_A_1478 PDB CREDO	0.643	0.132	0.563	0.004
Rv3286c.1	6	3cs9_NIL_C_600 PDB CREDO	0.593	0.187	0.562	0.004
Rv3286c.1	6	3gp0_NIL_A_1 PDB CREDO	0.609	0.168	0.562	0.004
Rv3286c.1	6	3k5v_STI_A_2 PDB CREDO	0.594	0.186	0.562	0.004
Rv3286c.1	6	3oez_STI_A_601 PDB CREDO	0.627	0.148	0.561	0.004
Rv3286c.1	6	1uwj_BAX_B_1723 PDB CREDO	0.663	0.112	0.559	0.004
Rv3286c.1	6	2hyy_STI_D_600 PDB CREDO	0.622	0.153	0.556	0.004
Rv3286c.1	2	3lxe_TOR_B_262 PDB CREDO	0.599	0.180	0.556	0.005
Rv3286c.1	6	3cs9_NIL_D_600 PDB CREDO	0.587	0.195	0.556	0.005
Rv3286c.1	6	3gcs_BAX_A_401 PDB CREDO	0.659	0.115	0.556	0.005
Rv3286c.1	2	3hku_TOR_A_300 PDB CREDO	0.555	0.237	0.555	0.005
Rv3286c.1	6	2hyy_STI_A_600 PDB CREDO	0.620	0.156	0.555	0.005
Rv3286c.1	2	3lxe_TOR_A_262 PDB CREDO	0.597	0.182	0.554	0.005
Rv3286c.1	6	3ms9_STI_B_1 PDB CREDO	0.619	0.156	0.554	0.005
Rv3286c.1	6	3mss_STI_A_1 PDB CREDO	0.619	0.156	0.554	0.005
Rv3286c.1	6	1iep_STI_B_202 PDB CREDO	0.618	0.158	0.552	0.005
Rv3286c.1	6	3mss_STI_C_1 PDB CREDO	0.617	0.159	0.552	0.005
Rv3286c.1	6	1iep_STI_A_201 PDB CREDO	0.617	0.159	0.552	0.005
Rv3286c.1	6	3gvu_STI_A_1001 PDB CREDO	0.617	0.159	0.552	0.005
Rv3286c.1	6	3mss_STI_B_1 PDB CREDO	0.617	0.160	0.551	0.005
Rv3286c.1	6	3ms9_STI_A_1 PDB CREDO	0.616	0.160	0.551	0.005
Rv3286c.1	6	3mss_STI_D_1 PDB CREDO	0.616	0.160	0.551	0.005
Rv3286c.1	6	3k5v_STI_B_2 PDB CREDO	0.616	0.161	0.551	0.005
Rv3286c.1	6	3pyy_STI_B_4 PDB CREDO	0.615	0.161	0.550	0.005
Rv3286c.1	6	2hyy_STI_C_600 PDB CREDO	0.614	0.163	0.549	0.005
Rv3286c.1	6	3pyy_STI_A_3 PDB CREDO	0.614	0.163	0.549	0.005
Rv3286c.1	6	1uwh_BAX_B_1723 PDB CREDO	0.690	0.089	0.548	0.005
Rv3286c.1	6	1uwh_BAX_A_1723 PDB CREDO	0.688	0.090	0.546	0.005
Rv3286c.1	6	3heg_BAX_A_1 PDB CREDO	0.662	0.113	0.542	0.006
Rv3286c.1	6	3kk6_CEL_B_1701 PDB CREDO	0.540	0.258	0.540	0.006
Rv3286c.1	6	3nxu_RIT_B_600 PDB CREDO	0.540	0.258	0.540	0.006
Rv3286c.1	2	1ynn_RFP_C_1120 PDB CREDO	0.558	0.233	0.538	0.006
Rv3286c.1	6	3nxu_RIT_A_600 PDB CREDO	0.538	0.261	0.538	0.006
Rv3286c.1	6	2hyy_STI_B_600 PDB CREDO	0.656	0.118	0.537	0.006
Rv3286c.1	6	2oiq_STI_A_1001 PDB CREDO	0.655	0.120	0.536	0.006
Rv3286c.1	6	1skx_RFP_A_1 PDB CREDO	0.534	0.267	0.534	0.006
Rv3286c.1	6	3bjw_SVR_B_501 PDB CREDO	0.591	0.191	0.531	0.007
Rv3286c.1	6	3bjw_SVR_F_502 PDB CREDO	0.588	0.193	0.529	0.007
Rv3286c.1	6	3bjw_SVR_H_504 PDB CREDO	0.588	0.194	0.529	0.007
Rv3286c.1	6	3hec_STI_A_1 PDB CREDO	0.701	0.080	0.524	0.008
Rv3286c.1	6	3b0w_DGX_A_1 PDB CREDO	0.617	0.159	0.521	0.008
Rv3286c.1	6	3oez_STI_B_601 PDB CREDO	0.697	0.083	0.520	0.008
Rv3286c.1	6	2pl0_STI_A_200 PDB CREDO	0.632	0.143	0.518	0.008
Rv3286c.1	6	3rgf_BAX_A_465 PDB CREDO	0.562	0.228	0.517	0.008
Rv3286c.1	6	3frq_ERY_A_195 PDB CREDO	0.593	0.187	0.515	0.009
Rv3286c.1	6	3sm2_478_A_126 PDB CREDO	0.603	0.176	0.515	0.009
Rv3286c.1	6	1y0x_T44_X_500 PDB CREDO	0.648	0.126	0.515	0.009
Rv3286c.1	2	3znc_BZ1_A_500 PDB CREDO	0.554	0.238	0.514	0.009
Rv3286c.1	2	2a69_RPT_C_8001 PDB CREDO	0.532	0.269	0.513	0.009
Rv3286c.1	6	1err_RAL_A_600 PDB CREDO	0.662	0.112	0.510	0.009
Rv3286c.1	6	2jfa_RAL_B_600 PDB CREDO	0.662	0.112	0.510	0.009
Rv3286c.1	6	1uob_PNN_A_1311 PDB CREDO	0.621	0.154	0.509	0.010
Rv3286c.1	2	2a68_RBT_C_8001 PDB CREDO	0.527	0.277	0.508	0.010
Rv3286c.1	2	2a68_RBT_M_8002 PDB CREDO	0.528	0.276	0.508	0.010
Rv3286c.1	2	3sv9_SV6_A_1 PDB CREDO	0.548	0.247	0.508	0.010
Rv3286c.1	6	1err_RAL_B_600 PDB CREDO	0.660	0.115	0.508	0.010
Rv3286c.1	6	2hw2_RFP_A_1200 PDB CREDO	0.681	0.096	0.508	0.010
Rv3286c.1	6	1bsx_T3_A_1 PDB CREDO	0.722	0.065	0.506	0.010
Rv3286c.1	6	1bsx_T3_B_2 PDB CREDO	0.722	0.065	0.506	0.010
Rv3286c.1	6	3uvv_T3_A_501 PDB CREDO	0.699	0.081	0.506	0.010
Rv3286c.1	6	1xzx_T3_X_500 PDB CREDO	0.699	0.082	0.505	0.010
Rv3286c.1	6	2jfa_RAL_A_600 PDB CREDO	0.675	0.102	0.504	0.010
Rv3286c.1	6	3el9_DR7_A_100 PDB CREDO	0.516	0.293	0.502	0.011
Rv3286c.1	6	2fxd_DR7_A_102 PDB CREDO	0.516	0.294	0.502	0.011
Rv3286c.1	2	3k2h_LYA_B_514 PDB CREDO	0.539	0.259	0.502	0.011
Rv3286c.1	6	3gws_T3_X_500 PDB CREDO	0.716	0.069	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions