SInCRe - Rv3223c

Tuberculist information

Gene name	sigH
Protein function	Alternative RNA polymerase sigma-E factor (sigma-24) SigH (RPOE)
Functional category(tuberculist)	information pathways
Gene location(kb)	3598.9
Molecular mass(da)	24225.1
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 216

	  		  	1    MADIDGVTGSAGLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQE   60
			  	61   TMVKAYAGFRSFRHGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEQITDWQLASNAEH  120
			  	121  SSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTV  180
			  	181  MSRLHRGRRQLRGLLADVARDRGFARGEQAHEGVSS

Known structures in the PDB

No Known structures

Number of amino acids : 216

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Sigma70_r2	PF04542	34-100
Sigma70_r4_2	PF08281	138-191

Mtb Structural Proteome models

Model Number	1
Model name	Rv3223c
Template	1H3L APDB CREDO
Template coverage	31_102
Template Identity(%)	77.8
Model coverage(%)	32.9
Normalized DOPE score	-1.984

Model Number	2
Model name	Rv3223c.1
Template	1OR7 APDB CREDO
Template coverage	2_187
Template Identity(%)	28.1
Model coverage(%)	83.3
Normalized DOPE score	-0.099

Structure Models from Chopin

Model Number	1
Profile	a.177.1.1, a.4.13.2 - 1.10.10.10, 1.10.1740.10 Click for model details
zscore	31.67
Residue begin	6
Residue end	200

Model Number	2
Profile	a.177.1.1 - 1.10.1740.10 Click for model details
zscore	20.53
Residue begin	21
Residue end	95

Model Number	3
Profile	a.177.1.1 Click for model details
zscore	12.28
Residue begin	6
Residue end	119

Model Number	4
Profile	a.4.13.2 - 1.10.10.10 Click for model details
zscore	10.64
Residue begin	126
Residue end	212

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3223c	Gene name	Confidence Score
Rv2710	sigB	0.947
Rv2710	sigB	0.947
Rv2710	sigB	0.947
Rv2710	sigB	0.947
Rv3221A	rshA	0.945
Rv2703	sigA	0.932
Rv2703	sigA	0.932
Rv2703	sigA	0.932
Rv2703	sigA	0.932
Rv3286c	sigF	0.924
Rv3286c	sigF	0.924
Rv3286c	sigF	0.924

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3223c.1	3	3ndu_ROC_D_100 PDB CREDO	0.623	0.153	0.623	0.001
Rv3223c.1	3	3k4v_ROC_D_201 PDB CREDO	0.649	0.125	0.620	0.001
Rv3223c.1	3	3ndt_ROC_D_100 PDB CREDO	0.677	0.099	0.617	0.002
Rv3223c.1	3	2nnk_ROC_A_401 PDB CREDO	0.677	0.100	0.616	0.002
Rv3223c.1	3	2nmy_ROC_A_401 PDB CREDO	0.630	0.145	0.616	0.002
Rv3223c.1	3	1k6c_MK1_B_902 PDB CREDO	0.652	0.123	0.608	0.002
Rv3223c.1	3	3cyx_ROC_A_201 PDB CREDO	0.604	0.175	0.604	0.002
Rv3223c.1	3	1t7i_017_A_200 PDB CREDO	0.643	0.132	0.600	0.002
Rv3223c.1	3	3oxc_ROC_A_401 PDB CREDO	0.668	0.107	0.598	0.002
Rv3223c.1	3	3el4_ROC_A_100 PDB CREDO	0.637	0.137	0.594	0.002
Rv3223c.1	3	2nnp_ROC_A_401 PDB CREDO	0.634	0.141	0.591	0.002
Rv3223c.1	3	3tkg_ROC_C_901 PDB CREDO	0.604	0.174	0.590	0.003
Rv3223c.1	3	3jw2_017_A_401 PDB CREDO	0.646	0.128	0.589	0.003
Rv3223c.1	3	2ieo_017_A_402 PDB CREDO	0.616	0.160	0.588	0.003
Rv3223c.1	3	3d1y_ROC_A_201 PDB CREDO	0.678	0.099	0.588	0.003
Rv3223c.1	3	1rl8_RIT_A_9001 PDB CREDO	0.677	0.100	0.587	0.003
Rv3223c.1	3	3qoz_017_A_201 PDB CREDO	0.599	0.180	0.586	0.003
Rv3223c.1	3	3pwr_ROC_A_401 PDB CREDO	0.658	0.117	0.585	0.003
Rv3223c.1	3	2avv_MK1_E_902 PDB CREDO	0.625	0.150	0.583	0.003
Rv3223c.1	3	1hxb_ROC_A_100 PDB CREDO	0.688	0.090	0.582	0.003
Rv3223c.1	3	3jvy_017_B_401 PDB CREDO	0.607	0.171	0.580	0.003
Rv3223c.1	3	2avv_MK1_A_901 PDB CREDO	0.615	0.161	0.574	0.003
Rv3223c.1	3	3d20_017_A_201 PDB CREDO	0.585	0.198	0.572	0.003
Rv3223c.1	3	2hs2_017_A_201 PDB CREDO	0.625	0.150	0.569	0.004
Rv3223c.1	3	1sdt_MK1_B_902 PDB CREDO	0.638	0.137	0.567	0.004
Rv3223c.1	3	3tl9_ROC_A_401 PDB CREDO	0.606	0.172	0.566	0.004
Rv3223c.1	3	3tkg_ROC_B_801 PDB CREDO	0.660	0.115	0.566	0.004
Rv3223c.1	3	3oxx_DR7_C_100 PDB CREDO	0.652	0.123	0.565	0.004
Rv3223c.1	3	1hxw_RIT_B_301 PDB CREDO	0.720	0.066	0.565	0.004
Rv3223c.1	3	1c6z_ROC_B_505 PDB CREDO	0.665	0.110	0.563	0.004
Rv3223c.1	3	2aqu_DR7_B_300 PDB CREDO	0.682	0.096	0.563	0.004
Rv3223c.1	3	3s43_478_A_401 PDB CREDO	0.648	0.126	0.562	0.004
Rv3223c.1	3	3d1z_017_B_201 PDB CREDO	0.617	0.159	0.562	0.004
Rv3223c.1	19	1hwk_117_C_4 PDB CREDO	0.578	0.206	0.561	0.004
Rv3223c.1	3	2o4k_DR7_A_301 PDB CREDO	0.574	0.212	0.561	0.004
Rv3223c.1	19	1hwk_117_A_2 PDB CREDO	0.576	0.208	0.560	0.004
Rv3223c.1	3	3cyw_017_A_201 PDB CREDO	0.599	0.180	0.559	0.004
Rv3223c.1	3	3d1x_ROC_A_201 PDB CREDO	0.624	0.151	0.558	0.004
Rv3223c.1	3	3ndx_RIT_A_100 PDB CREDO	0.597	0.182	0.557	0.004
Rv3223c.1	3	1t3r_017_A_1200 PDB CREDO	0.625	0.150	0.556	0.005
Rv3223c.1	3	3oxx_DR7_A_100 PDB CREDO	0.673	0.103	0.556	0.005
Rv3223c.1	3	1c6y_MK1_B_524 PDB CREDO	0.763	0.041	0.553	0.005
Rv3223c.1	19	1hwk_117_B_1 PDB CREDO	0.569	0.218	0.553	0.005
Rv3223c.1	19	1hwk_117_D_3 PDB CREDO	0.604	0.174	0.552	0.005
Rv3223c.1	3	3ucb_017_A_201 PDB CREDO	0.606	0.172	0.552	0.005
Rv3223c.1	19	1hwl_FBI_B_1 PDB CREDO	0.585	0.197	0.552	0.005
Rv3223c.1	3	1sh9_RIT_B_301 PDB CREDO	0.761	0.042	0.551	0.005
Rv3223c.1	3	3ekx_1UN_B_201 PDB CREDO	0.685	0.093	0.551	0.005
Rv3223c.1	3	3ogq_AB1_A_200 PDB CREDO	0.684	0.093	0.551	0.005
Rv3223c.1	3	2ien_017_B_402 PDB CREDO	0.576	0.209	0.550	0.005
Rv3223c.1	3	3k4v_ROC_B_201 PDB CREDO	0.655	0.119	0.550	0.005
Rv3223c.1	3	3ndt_ROC_A_101 PDB CREDO	0.668	0.107	0.550	0.005
Rv3223c.1	3	1ohr_1UN_A_201 PDB CREDO	0.757	0.044	0.549	0.005
Rv3223c.1	3	2f80_017_B_301 PDB CREDO	0.649	0.126	0.549	0.005
Rv3223c.1	19	1hwl_FBI_D_3 PDB CREDO	0.583	0.201	0.549	0.005
Rv3223c.1	3	3nuj_478_B_401 PDB CREDO	0.648	0.126	0.549	0.005
Rv3223c.1	3	3eky_DR7_A_100 PDB CREDO	0.698	0.082	0.548	0.005
Rv3223c.1	3	3s56_ROC_A_201 PDB CREDO	0.755	0.045	0.547	0.005
Rv3223c.1	19	1hwl_FBI_C_4 PDB CREDO	0.580	0.204	0.546	0.005
Rv3223c.1	3	3em4_DR7_V_100 PDB CREDO	0.696	0.084	0.546	0.005
Rv3223c.1	19	1hwl_FBI_A_2 PDB CREDO	0.579	0.205	0.546	0.005
Rv3223c.1	3	1hsh_MK1_C_402 PDB CREDO	0.751	0.047	0.545	0.005
Rv3223c.1	3	2fxe_DR7_A_102 PDB CREDO	0.694	0.086	0.544	0.006
Rv3223c.1	3	2r5p_MK1_D_902 PDB CREDO	0.694	0.086	0.544	0.006
Rv3223c.1	3	3s54_017_B_201 PDB CREDO	0.621	0.155	0.544	0.006
Rv3223c.1	3	4dqf_017_B_101 PDB CREDO	0.675	0.101	0.543	0.006
Rv3223c.1	3	2avo_MK1_B_902 PDB CREDO	0.640	0.134	0.542	0.006
Rv3223c.1	3	2r5p_MK1_B_902 PDB CREDO	0.691	0.088	0.542	0.006
Rv3223c.1	3	1hsh_MK1_A_401 PDB CREDO	0.747	0.049	0.542	0.006
Rv3223c.1	3	3ndw_RIT_A_100 PDB CREDO	0.625	0.151	0.542	0.006
Rv3223c.1	3	3ggu_017_B_201 PDB CREDO	0.689	0.089	0.541	0.006
Rv3223c.1	3	2o4l_TPV_A_403 PDB CREDO	0.540	0.258	0.540	0.006
Rv3223c.1	3	3ekv_478_A_200 PDB CREDO	0.671	0.105	0.540	0.006
Rv3223c.1	3	1sdu_MK1_B_902 PDB CREDO	0.671	0.105	0.540	0.006
Rv3223c.1	3	3ekq_ROC_A_100 PDB CREDO	0.763	0.041	0.538	0.006
Rv3223c.1	3	2fxd_DR7_A_102 PDB CREDO	0.742	0.052	0.538	0.006
Rv3223c.1	3	2f81_017_A_302 PDB CREDO	0.549	0.245	0.537	0.006
Rv3223c.1	3	3el9_DR7_A_100 PDB CREDO	0.741	0.053	0.537	0.006
Rv3223c.1	3	3nu5_478_B_401 PDB CREDO	0.613	0.164	0.536	0.006
Rv3223c.1	2	3g0f_B49_A_9001 PDB CREDO	0.536	0.264	0.536	0.006
Rv3223c.1	3	3bvb_017_B_401 PDB CREDO	0.603	0.176	0.536	0.006
Rv3223c.1	3	3nu4_478_B_401 PDB CREDO	0.720	0.067	0.536	0.006
Rv3223c.1	3	4dqb_017_B_101 PDB CREDO	0.719	0.067	0.535	0.006
Rv3223c.1	3	2avs_MK1_B_902 PDB CREDO	0.632	0.143	0.535	0.006
Rv3223c.1	3	3nuo_478_B_478 PDB CREDO	0.700	0.081	0.535	0.006
Rv3223c.1	3	3em3_478_B_200 PDB CREDO	0.663	0.112	0.533	0.007
Rv3223c.1	3	1sdv_MK1_B_902 PDB CREDO	0.716	0.069	0.533	0.007
Rv3223c.1	2	3g0f_B49_B_9001 PDB CREDO	0.533	0.269	0.533	0.007
Rv3223c.1	3	3el5_1UN_B_201 PDB CREDO	0.645	0.129	0.532	0.007
Rv3223c.1	3	3ekw_DR7_B_100 PDB CREDO	0.660	0.115	0.531	0.007
Rv3223c.1	3	3el1_DR7_A_100 PDB CREDO	0.660	0.115	0.531	0.007
Rv3223c.1	3	3oxv_478_C_200 PDB CREDO	0.713	0.071	0.531	0.007
Rv3223c.1	19	1uob_PNN_A_1311 PDB CREDO	0.560	0.230	0.528	0.007
Rv3223c.1	5	1fmo_ADN_E_351 PDB CREDO	0.573	0.213	0.527	0.007
Rv3223c.1	3	3nu6_478_B_401 PDB CREDO	0.744	0.051	0.525	0.007
Rv3223c.1	3	2f8g_017_B_401 PDB CREDO	0.599	0.180	0.524	0.008
Rv3223c.1	3	3tkw_017_B_401 PDB CREDO	0.573	0.213	0.524	0.008
Rv3223c.1	3	2pym_1UN_A_1001 PDB CREDO	0.619	0.158	0.524	0.008
Rv3223c.1	3	3t3c_017_A_201 PDB CREDO	0.742	0.053	0.523	0.008
Rv3223c.1	19	1hwi_115_D_3 PDB CREDO	0.609	0.169	0.523	0.008
Rv3223c.1	3	2q64_1UN_B_1001 PDB CREDO	0.618	0.158	0.523	0.008
Rv3223c.1	2	3mdv_CL6_A_506 PDB CREDO	0.522	0.284	0.522	0.008
Rv3223c.1	3	2b60_RIT_B_100 PDB CREDO	0.682	0.095	0.521	0.008
Rv3223c.1	19	1hwi_115_B_1 PDB CREDO	0.606	0.172	0.520	0.008
Rv3223c.1	3	2qak_1UN_A_1001 PDB CREDO	0.615	0.162	0.520	0.008
Rv3223c.1	3	3em4_DR7_A_100 PDB CREDO	0.716	0.069	0.519	0.008
Rv3223c.1	3	3pwm_017_B_402 PDB CREDO	0.584	0.198	0.519	0.008
Rv3223c.1	3	2pyn_1UN_A_1001 PDB CREDO	0.613	0.164	0.519	0.008
Rv3223c.1	3	2q63_1UN_A_1001 PDB CREDO	0.612	0.165	0.518	0.008
Rv3223c.1	3	2o4s_AB1_A_400 PDB CREDO	0.579	0.205	0.518	0.008
Rv3223c.1	3	3s53_017_A_201 PDB CREDO	0.755	0.045	0.518	0.008
Rv3223c.1	3	4dqc_017_A_101 PDB CREDO	0.734	0.057	0.518	0.008
Rv3223c.1	3	1hsg_MK1_B_902 PDB CREDO	0.714	0.070	0.518	0.008
Rv3223c.1	5	2fum_MIX_C_2539 PDB CREDO	0.584	0.198	0.517	0.008
Rv3223c.1	3	2rkf_AB1_A_501 PDB CREDO	0.658	0.117	0.516	0.009
Rv3223c.1	5	1kij_NOV_B_444 PDB CREDO	0.628	0.147	0.514	0.009
Rv3223c.1	2	3uq6_ADN_B_401 PDB CREDO	0.538	0.261	0.514	0.009
Rv3223c.1	2	3uq6_ADN_A_401 PDB CREDO	0.537	0.262	0.513	0.009
Rv3223c.1	19	1uwj_BAX_A_1723 PDB CREDO	0.543	0.254	0.513	0.009
Rv3223c.1	2	1v8b_ADN_D_3502 PDB CREDO	0.611	0.166	0.512	0.009
Rv3223c.1	3	4dqh_017_B_101 PDB CREDO	0.745	0.051	0.511	0.009
Rv3223c.1	3	2q5k_AB1_A_201 PDB CREDO	0.724	0.064	0.511	0.009
Rv3223c.1	3	3n3i_ROC_A_201 PDB CREDO	0.742	0.053	0.509	0.009
Rv3223c.1	2	1v8b_ADN_A_502 PDB CREDO	0.533	0.269	0.509	0.009
Rv3223c.1	3	1sgu_MK1_B_2632 PDB CREDO	0.804	0.023	0.507	0.010
Rv3223c.1	3	3nu9_478_A_401 PDB CREDO	0.760	0.043	0.507	0.010
Rv3223c.1	3	3em6_017_A_200 PDB CREDO	0.759	0.043	0.507	0.010
Rv3223c.1	3	3mws_017_B_201 PDB CREDO	0.589	0.192	0.505	0.010
Rv3223c.1	3	2bpx_MK1_B_902 PDB CREDO	0.756	0.045	0.505	0.010
Rv3223c.1	3	3lzu_017_A_200 PDB CREDO	0.696	0.084	0.505	0.010
Rv3223c.1	19	1z2b_VLB_C_800 PDB CREDO	0.536	0.265	0.505	0.010
Rv3223c.1	19	3tkd_CYZ_A_266 PDB CREDO	0.587	0.195	0.504	0.010
Rv3223c.1	2	3ubo_ADN_B_353 PDB CREDO	0.575	0.210	0.503	0.010
Rv3223c.1	3	1hpv_478_B_200 PDB CREDO	0.752	0.046	0.502	0.011
Rv3223c.1	19	3tkd_CYZ_B_267 PDB CREDO	0.549	0.245	0.502	0.011
Rv3223c.1	5	2zva_1N1_A_513 PDB CREDO	0.567	0.220	0.502	0.011
Rv3223c.1	19	3frq_ERY_A_195 PDB CREDO	0.502	0.316	0.502	0.011
Rv3223c.1	5	3tbg_RTZ_A_1 PDB CREDO	0.501	0.317	0.501	0.011
Rv3223c.1	2	3ubo_ADN_A_353 PDB CREDO	0.572	0.214	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions