SInCRe - Rv2069

Tuberculist information

Gene name	sigC
Protein function	RNA polymerase sigma factor, ECF subfamily, SigC
Functional category(tuberculist)	information pathways
Gene location(kb)	2326.94
Molecular mass(da)	19965.5
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 185

	  		  	1    MTATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLR   60
			  	61   AIGAIPRFSARSSARTWLLAIARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFED  120
			  	121  LVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVGTIRSRVARARDALLADAEP  180
			  	181  DDLTG

Known structures in the PDB

	PDB ID	2O7G
	Total residue count	224
	Number of chains	2
	Method	X-RAY
	Resolution	2.7

	PDB ID	2O8X
	Total residue count	210
	Number of chains	3
	Method	X-RAY
	Resolution	3

Number of amino acids : 185

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Sigma70_r2	PF04542	29-96
Sigma70_r4_2	PF08281	121-174

Mtb Structural Proteome models

Model Number	1
Model name	Rv2069_2o7g_A
Template	2O7G APDB CREDO
Template coverage	4_91
Template Identity(%)	100.0
Model coverage(%)	47.0
Normalized DOPE score	-2.307

Model Number	2
Model name	Rv2069
Template	1OR7 APDB CREDO
Template coverage	-1_187
Template Identity(%)	30.3
Model coverage(%)	95.7
Normalized DOPE score	-0.12

Model Number	3
Model name	Rv2069_2o8x_A
Template	2O8X APDB CREDO
Template coverage	116_176
Template Identity(%)	100.0
Model coverage(%)	32.4
Normalized DOPE score	0.123

Structure Models from Chopin

Model Number	1
Profile	a.177.1.1, a.4.13.2 - 1.10.10.10, 1.10.1740.10 Click for model details
zscore	29.71
Residue begin	3
Residue end	183

Model Number	2
Profile	a.177.1.1 - 1.10.1740.10 Click for model details
zscore	23.62
Residue begin	18
Residue end	91

Model Number	3
Profile	a.177.1.1 Click for model details
zscore	15.69
Residue begin	3
Residue end	115

Model Number	4
Profile	a.4.13.2 - 1.10.10.10 Click for model details
zscore	9.59
Residue begin	109
Residue end	185

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2069	Gene name	Confidence Score
Rv3911	sigM	0.933
Rv3911	sigM	0.933
Rv3286c	sigF	0.918
Rv3286c	sigF	0.918
Rv3286c	sigF	0.918
Rv2703	sigA	0.911
Rv2703	sigA	0.911
Rv2703	sigA	0.911
Rv2703	sigA	0.911

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2069_2o8x_A	2	3oht_1N1_B_1000 PDB CREDO	0.677	0.099	0.654	0.001
Rv2069_2o8x_A	2	1s9p_DES_A_459 PDB CREDO	0.641	0.133	0.619	0.001
Rv2069_2o8x_A	2	3erd_DES_B_800 PDB CREDO	0.658	0.116	0.613	0.002
Rv2069_2o8x_A	2	3spk_TPV_A_100 PDB CREDO	0.656	0.119	0.612	0.002
Rv2069_2o8x_A	2	3bbt_FMM_D_91 PDB CREDO	0.625	0.150	0.604	0.002
Rv2069_2o8x_A	2	2fum_MIX_D_3539 PDB CREDO	0.623	0.152	0.602	0.002
Rv2069_2o8x_A	2	1jg2_ADN_A_500 PDB CREDO	0.601	0.178	0.601	0.002
Rv2069_2o8x_A	2	1s9p_DES_D_600 PDB CREDO	0.619	0.157	0.598	0.002
Rv2069_2o8x_A	2	3oht_1N1_A_1000 PDB CREDO	0.688	0.090	0.596	0.002
Rv2069_2o8x_A	2	2jfa_RAL_A_600 PDB CREDO	0.713	0.071	0.585	0.003
Rv2069_2o8x_A	2	3erd_DES_A_600 PDB CREDO	0.627	0.149	0.584	0.003
Rv2069_2o8x_A	2	1qkn_RAL_A_600 PDB CREDO	0.653	0.121	0.571	0.004
Rv2069_2o8x_A	2	2jfa_RAL_B_600 PDB CREDO	0.716	0.069	0.569	0.004
Rv2069_2o8x_A	2	3v5w_8PR_A_701 PDB CREDO	0.649	0.126	0.567	0.004
Rv2069_2o8x_A	2	3bbt_FMM_B_91 PDB CREDO	0.679	0.098	0.566	0.004
Rv2069_2o8x_A	2	2ito_IRE_A_2020 PDB CREDO	0.678	0.099	0.565	0.004
Rv2069_2o8x_A	2	1mx1_THA_C_3 PDB CREDO	0.585	0.198	0.564	0.004
Rv2069_2o8x_A	2	2y6o_1N1_A_1892 PDB CREDO	0.666	0.109	0.564	0.004
Rv2069_2o8x_A	2	1err_RAL_B_600 PDB CREDO	0.709	0.074	0.563	0.004
Rv2069_2o8x_A	2	3lfa_1N1_A_361 PDB CREDO	0.825	0.017	0.563	0.004
Rv2069_2o8x_A	2	1err_RAL_A_600 PDB CREDO	0.707	0.076	0.562	0.004
Rv2069_2o8x_A	2	3hec_STI_A_1 PDB CREDO	0.685	0.093	0.562	0.004
Rv2069_2o8x_A	2	1mx1_THA_E_5 PDB CREDO	0.623	0.153	0.560	0.004
Rv2069_2o8x_A	2	1jg3_ADN_A_500 PDB CREDO	0.621	0.155	0.558	0.004
Rv2069_2o8x_A	2	2fum_MIX_A_539 PDB CREDO	0.595	0.185	0.554	0.005
Rv2069_2o8x_A	2	3ols_EST_A_600 PDB CREDO	0.742	0.052	0.550	0.005
Rv2069_2o8x_A	2	1g50_EST_A_600 PDB CREDO	0.741	0.053	0.549	0.005
Rv2069_2o8x_A	2	2yja_EST_B_1550 PDB CREDO	0.741	0.053	0.549	0.005
Rv2069_2o8x_A	2	3ols_EST_B_600 PDB CREDO	0.740	0.053	0.549	0.005
Rv2069_2o8x_A	2	3uud_EST_A_600 PDB CREDO	0.740	0.054	0.548	0.005
Rv2069_2o8x_A	2	2xkw_P1B_B_1475 PDB CREDO	0.587	0.195	0.547	0.005
Rv2069_2o8x_A	2	3uud_EST_B_600 PDB CREDO	0.738	0.055	0.547	0.005
Rv2069_2o8x_A	2	3oez_STI_B_601 PDB CREDO	0.666	0.109	0.546	0.005
Rv2069_2o8x_A	2	3oct_1N1_A_663 PDB CREDO	0.545	0.251	0.545	0.005
Rv2069_2o8x_A	2	3heg_BAX_A_1 PDB CREDO	0.725	0.063	0.542	0.006
Rv2069_2o8x_A	2	1t7j_478_A_200 PDB CREDO	0.702	0.079	0.541	0.006
Rv2069_2o8x_A	2	2zva_1N1_A_513 PDB CREDO	0.697	0.083	0.538	0.006
Rv2069_2o8x_A	2	3u7s_017_A_201 PDB CREDO	0.574	0.212	0.536	0.006
Rv2069_2o8x_A	2	3gcs_BAX_A_401 PDB CREDO	0.736	0.056	0.534	0.006
Rv2069_2o8x_A	2	1sn5_T3_C_601 PDB CREDO	0.783	0.032	0.534	0.006
Rv2069_2o8x_A	2	4asd_BAX_A_1500 PDB CREDO	0.734	0.057	0.533	0.007
Rv2069_2o8x_A	2	3so9_017_A_100 PDB CREDO	0.690	0.089	0.531	0.007
Rv2069_2o8x_A	2	3spk_TPV_B_100 PDB CREDO	0.754	0.046	0.531	0.007
Rv2069_2o8x_A	2	3qlg_1N1_A_601 PDB CREDO	0.661	0.114	0.531	0.007
Rv2069_2o8x_A	2	2ity_IRE_A_2020 PDB CREDO	0.687	0.091	0.530	0.007
Rv2069_2o8x_A	2	3qlg_1N1_B_601 PDB CREDO	0.661	0.114	0.530	0.007
Rv2069_2o8x_A	2	3g5d_1N1_B_1 PDB CREDO	0.660	0.115	0.529	0.007
Rv2069_2o8x_A	2	3ogp_017_A_200 PDB CREDO	0.705	0.077	0.527	0.007
Rv2069_2o8x_A	2	3g5d_1N1_A_1 PDB CREDO	0.655	0.120	0.525	0.007
Rv2069_2o8x_A	2	3k54_1N1_A_1 PDB CREDO	0.585	0.198	0.525	0.007
Rv2069_2o8x_A	2	1n49_RIT_D_401 PDB CREDO	0.767	0.039	0.525	0.007
Rv2069_2o8x_A	2	1s9p_DES_C_500 PDB CREDO	0.675	0.102	0.520	0.008
Rv2069_2o8x_A	2	1s9p_DES_B_459 PDB CREDO	0.668	0.107	0.515	0.009
Rv2069_2o8x_A	2	2gqg_1N1_A_501 PDB CREDO	0.553	0.239	0.515	0.009
Rv2069_2o8x_A	2	1mx1_THA_D_4 PDB CREDO	0.666	0.109	0.514	0.009
Rv2069_2o8x_A	2	3adx_IMN_B_3 PDB CREDO	0.693	0.086	0.514	0.009
Rv2069_2o8x_A	2	1mx1_THA_F_6 PDB CREDO	0.665	0.110	0.513	0.009
Rv2069_2o8x_A	2	3u7s_017_A_202 PDB CREDO	0.605	0.173	0.512	0.009
Rv2069_2o8x_A	2	2itz_IRE_A_2021 PDB CREDO	0.687	0.091	0.509	0.010
Rv2069_2o8x_A	2	3ads_IMN_B_3 PDB CREDO	0.778	0.034	0.509	0.010
Rv2069_2o8x_A	2	3rif_IVM_A_403 PDB CREDO	0.546	0.249	0.509	0.010
Rv2069_2o8x_A	2	2o4n_TPV_A_300 PDB CREDO	0.660	0.115	0.509	0.010
Rv2069_2o8x_A	2	2j7y_E3O_A_1454 PDB CREDO	0.609	0.169	0.508	0.010
Rv2069_2o8x_A	2	2pl0_STI_A_200 PDB CREDO	0.678	0.099	0.507	0.010
Rv2069_2o8x_A	2	1zgy_BRL_A_503 PDB CREDO	0.540	0.259	0.504	0.010
Rv2069_2o8x_A	2	1d4s_TPV_A_201 PDB CREDO	0.539	0.260	0.503	0.010
Rv2069_2o8x_A	2	1ya4_CTX_C_3 PDB CREDO	0.650	0.124	0.502	0.011
Rv2069_2o8x_A	2	1ya4_CTX_B_2 PDB CREDO	0.649	0.125	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
sulfatePubChem	0.9	96.0626
hydron sulfatePubChem	0.9	196.157