SInCRe - Rv0848

Tuberculist information

Gene name	cysK2
Protein function	Possible cysteine synthase a CysK2 (O-acetylserine sulfhydrylase) (O-acetylserine (thiol)-lyase) (CSASE)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	944.938
Molecular mass(da)	40086.4
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 372

	  		  	1    VRSRQTRDRYRLLPEGYQVTPGRNRHPGTMVGNTPVLWIPELSGTSDPDRGFWAKLEGFN   60
			  	61   PGGMKDRPALYMVECARARGDIAPGAAIVESTGGTLGLGLALAGKVYRHPVTLVTDPGLE  120
			  	121  PIIARMLTAYGAGVDMVTQPHPVGGWQQARKDRVAQLMAEYPGAWNPNQYGNPDNVGAYR  180
			  	181  SLALELVAQLGRIDVLVCSVGTGGHSAGVARVLREFNPDMRLIGVDTIGSTIFGQPASNR  240
			  	241  LMRGLGSSIYPRNVDYRAFDEVHWVAPPEAVWACRSLAATHYASGGWSVGAVALVAGWAA  300
			  	301  RNLPADTTIAAVFPDGPQRYFDTIYNDAYCNEHELLGGQPPTEPDEIASPLDAVVTRWTR  360
			  	361  STTVIDPTQVVS

Known structures in the PDB

No Known structures

Number of amino acids : 372

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
PALP	PF00291	29-315

Mtb Structural Proteome models

Model Number	1
Model name	Rv0848
Template	1VE1 APDB CREDO
Template coverage	7_298
Template Identity(%)	37.3
Model coverage(%)	78.5
Normalized DOPE score	-0.557

Model Number	2
Model name	Rv0848.1
Template	1KL7 APDB CREDO
Template coverage	66_510
Template Identity(%)	10.5
Model coverage(%)	99.5
Normalized DOPE score	0.398

Structure Models from Chopin

Model Number	1
Profile	c.79.1.1 Click for model details
zscore	26.18
Residue begin	1
Residue end	350

Model Number	2
Profile	3.40.50.1100 Click for model details
zscore	15.32
Residue begin	91
Residue end	331

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0848	Gene name	Confidence Score
Rv2335	cysE	0.982
Rv2335	cysE	0.982
Rv1336	cysM	0.945
Rv2334	cysK1	0.936
Rv0849	Rv0849	0.935
Rv3340	metC	0.922
Rv2391	sirA	0.916
Rv2391	sirA	0.916

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0848.1	12	3sm2_478_A_126 PDB CREDO	0.680	0.097	0.602	0.002
Rv0848.1	12	2xkw_P1B_A_1478 PDB CREDO	0.681	0.096	0.587	0.003
Rv0848.1	12	1xkk_FMM_A_91 PDB CREDO	0.696	0.084	0.586	0.003
Rv0848.1	12	1t46_STI_A_3 PDB CREDO	0.726	0.062	0.580	0.003
Rv0848.1	10	3sxr_1N1_A_1 PDB CREDO	0.597	0.183	0.574	0.003
Rv0848.1	12	3prs_RIT_A_1001 PDB CREDO	0.609	0.168	0.567	0.004
Rv0848.1	12	1c6z_ROC_B_505 PDB CREDO	0.624	0.152	0.566	0.004
Rv0848.1	12	3bjw_SVR_F_502 PDB CREDO	0.671	0.104	0.565	0.004
Rv0848.1	12	2v0z_C41_C_1328 PDB CREDO	0.637	0.138	0.564	0.004
Rv0848.1	12	3bjw_SVR_B_501 PDB CREDO	0.669	0.107	0.562	0.004
Rv0848.1	10	1jin_KTN_A_801 PDB CREDO	0.584	0.198	0.562	0.004
Rv0848.1	10	3sxr_1N1_B_2 PDB CREDO	0.608	0.169	0.562	0.004
Rv0848.1	12	3bjw_SVR_H_504 PDB CREDO	0.668	0.108	0.562	0.004
Rv0848.1	12	3el4_ROC_A_100 PDB CREDO	0.560	0.230	0.560	0.004
Rv0848.1	12	1ya4_CTX_A_1 PDB CREDO	0.587	0.195	0.559	0.004
Rv0848.1	10	3fuu_ADN_A_0 PDB CREDO	0.557	0.234	0.557	0.004
Rv0848.1	10	3k2h_LYA_A_514 PDB CREDO	0.557	0.234	0.557	0.004
Rv0848.1	10	1jg3_ADN_B_550 PDB CREDO	0.557	0.235	0.557	0.004
Rv0848.1	10	3f4x_KLT_A_300 PDB CREDO	0.578	0.207	0.556	0.005
Rv0848.1	12	3cs9_NIL_D_600 PDB CREDO	0.694	0.085	0.554	0.005
Rv0848.1	12	3cs9_NIL_C_600 PDB CREDO	0.692	0.087	0.553	0.005
Rv0848.1	10	1jip_KTN_A_801 PDB CREDO	0.619	0.157	0.549	0.005
Rv0848.1	12	1uwj_BAX_A_1723 PDB CREDO	0.788	0.030	0.548	0.005
Rv0848.1	10	1ie4_T44_B_328 PDB CREDO	0.548	0.247	0.548	0.005
Rv0848.1	10	2trt_TAC_A_222 PDB CREDO	0.593	0.188	0.548	0.005
Rv0848.1	10	2xpw_OTC_A_222 PDB CREDO	0.545	0.251	0.545	0.005
Rv0848.1	10	3kw2_ADN_B_300 PDB CREDO	0.565	0.224	0.543	0.006
Rv0848.1	10	3ri5_IVM_D_349 PDB CREDO	0.561	0.229	0.540	0.006
Rv0848.1	10	3jwq_VIA_B_901 PDB CREDO	0.627	0.149	0.540	0.006
Rv0848.1	10	2vke_TAC_A_222 PDB CREDO	0.539	0.259	0.539	0.006
Rv0848.1	10	3ria_IVM_E_348 PDB CREDO	0.560	0.230	0.539	0.006
Rv0848.1	10	3rhw_IVM_D_348 PDB CREDO	0.560	0.231	0.538	0.006
Rv0848.1	10	3rif_IVM_E_402 PDB CREDO	0.560	0.231	0.538	0.006
Rv0848.1	12	2v0z_C41_O_1327 PDB CREDO	0.657	0.118	0.538	0.006
Rv0848.1	10	3rhw_IVM_B_348 PDB CREDO	0.559	0.232	0.538	0.006
Rv0848.1	10	3rhw_IVM_B_349 PDB CREDO	0.559	0.232	0.538	0.006
Rv0848.1	10	3rhw_IVM_D_349 PDB CREDO	0.559	0.232	0.538	0.006
Rv0848.1	10	3ria_IVM_A_348 PDB CREDO	0.559	0.232	0.538	0.006
Rv0848.1	10	2uxo_TAC_B_1211 PDB CREDO	0.582	0.201	0.538	0.006
Rv0848.1	10	3ri5_IVM_E_349 PDB CREDO	0.559	0.231	0.538	0.006
Rv0848.1	10	3ri5_IVM_B_349 PDB CREDO	0.558	0.233	0.537	0.006
Rv0848.1	12	1tco_FK5_C_509 PDB CREDO	0.622	0.154	0.536	0.006
Rv0848.1	10	3ria_IVM_C_350 PDB CREDO	0.557	0.234	0.536	0.006
Rv0848.1	12	3bjw_SVR_E_503 PDB CREDO	0.689	0.090	0.535	0.006
Rv0848.1	12	3kk6_CEL_A_701 PDB CREDO	0.636	0.138	0.535	0.006
Rv0848.1	10	1z9y_FUN_A_500 PDB CREDO	0.556	0.236	0.535	0.006
Rv0848.1	10	2o7o_DXT_A_222 PDB CREDO	0.579	0.205	0.535	0.006
Rv0848.1	10	3adx_IMN_B_3 PDB CREDO	0.579	0.205	0.535	0.006
Rv0848.1	12	3pww_ROC_A_1001 PDB CREDO	0.668	0.107	0.533	0.007
Rv0848.1	12	2qxs_RAL_B_600 PDB CREDO	0.705	0.077	0.533	0.007
Rv0848.1	10	2h42_VIA_B_902 PDB CREDO	0.618	0.158	0.532	0.007
Rv0848.1	10	3bbt_FMM_B_91 PDB CREDO	0.552	0.241	0.531	0.007
Rv0848.1	12	1opj_STI_A_3 PDB CREDO	0.721	0.066	0.531	0.007
Rv0848.1	12	2qxs_RAL_A_600 PDB CREDO	0.701	0.080	0.530	0.007
Rv0848.1	10	2xn5_FUN_A_1356 PDB CREDO	0.573	0.213	0.529	0.007
Rv0848.1	12	3gp0_NIL_A_1 PDB CREDO	0.646	0.129	0.529	0.007
Rv0848.1	10	2xn7_T44_A_1355 PDB CREDO	0.572	0.214	0.529	0.007
Rv0848.1	10	3ria_IVM_E_349 PDB CREDO	0.549	0.245	0.528	0.007
Rv0848.1	12	2nnk_ROC_A_401 PDB CREDO	0.541	0.257	0.528	0.007
Rv0848.1	12	3cs9_NIL_B_600 PDB CREDO	0.697	0.083	0.527	0.007
Rv0848.1	12	3ndt_ROC_D_100 PDB CREDO	0.539	0.260	0.526	0.007
Rv0848.1	12	1opj_STI_B_4 PDB CREDO	0.714	0.070	0.526	0.007
Rv0848.1	10	1a27_EST_A_350 PDB CREDO	0.525	0.280	0.525	0.007
Rv0848.1	10	1zgf_TRU_A_300 PDB CREDO	0.545	0.251	0.525	0.007
Rv0848.1	10	3rhw_IVM_A_348 PDB CREDO	0.545	0.251	0.525	0.007
Rv0848.1	12	3cs9_NIL_A_600 PDB CREDO	0.713	0.071	0.525	0.007
Rv0848.1	10	1ict_T44_C_128 PDB CREDO	0.590	0.191	0.523	0.008
Rv0848.1	10	3ri5_IVM_A_349 PDB CREDO	0.543	0.254	0.522	0.008
Rv0848.1	10	2xn6_T44_A_1370 PDB CREDO	0.565	0.224	0.522	0.008
Rv0848.1	10	1fr6_AZR_A_362 PDB CREDO	0.542	0.255	0.522	0.008
Rv0848.1	12	2q64_1UN_B_1001 PDB CREDO	0.574	0.212	0.521	0.008
Rv0848.1	10	2ity_IRE_A_2020 PDB CREDO	0.541	0.256	0.520	0.008
Rv0848.1	10	1lhu_EST_A_301 PDB CREDO	0.626	0.149	0.520	0.008
Rv0848.1	12	2qak_1UN_A_1001 PDB CREDO	0.573	0.213	0.520	0.008
Rv0848.1	12	3ufn_ROC_A_401 PDB CREDO	0.634	0.140	0.520	0.008
Rv0848.1	12	3k4v_ROC_D_201 PDB CREDO	0.532	0.269	0.520	0.008
Rv0848.1	10	1ya3_STR_C_3001 PDB CREDO	0.581	0.202	0.519	0.008
Rv0848.1	12	2pyn_1UN_A_1001 PDB CREDO	0.571	0.215	0.518	0.008
Rv0848.1	12	2pym_1UN_A_1001 PDB CREDO	0.570	0.216	0.518	0.008
Rv0848.1	10	1oq5_CEL_A_701 PDB CREDO	0.601	0.178	0.518	0.008
Rv0848.1	10	3aod_RFP_C_2002 PDB CREDO	0.579	0.205	0.517	0.008
Rv0848.1	12	3b0w_DGX_B_1 PDB CREDO	0.722	0.065	0.517	0.008
Rv0848.1	10	2pou_I7A_A_1000 PDB CREDO	0.537	0.263	0.517	0.008
Rv0848.1	12	2q63_1UN_A_1001 PDB CREDO	0.569	0.219	0.516	0.009
Rv0848.1	12	3k5v_STI_A_2 PDB CREDO	0.720	0.066	0.515	0.009
Rv0848.1	10	3jwq_VIA_D_901 PDB CREDO	0.664	0.111	0.515	0.009
Rv0848.1	10	3g0e_B49_A_9000 PDB CREDO	0.557	0.235	0.514	0.009
Rv0848.1	10	1jg3_ADN_A_500 PDB CREDO	0.575	0.210	0.514	0.009
Rv0848.1	10	2h42_VIA_C_903 PDB CREDO	0.597	0.183	0.514	0.009
Rv0848.1	10	1fr6_AZR_B_362 PDB CREDO	0.532	0.269	0.512	0.009
Rv0848.1	10	2w8y_NDR_B_1000 PDB CREDO	0.533	0.269	0.512	0.009
Rv0848.1	10	3h52_486_C_4 PDB CREDO	0.594	0.186	0.512	0.009
Rv0848.1	10	1fj8_CER_D_500 PDB CREDO	0.601	0.178	0.511	0.009
Rv0848.1	10	3kw2_ADN_A_300 PDB CREDO	0.551	0.242	0.511	0.009
Rv0848.1	12	1k6c_MK1_B_902 PDB CREDO	0.510	0.302	0.510	0.009
Rv0848.1	10	2itz_IRE_A_2021 PDB CREDO	0.552	0.241	0.510	0.009
Rv0848.1	10	2ito_IRE_A_2020 PDB CREDO	0.529	0.274	0.509	0.009
Rv0848.1	10	1mx1_THA_F_6 PDB CREDO	0.529	0.274	0.509	0.009
Rv0848.1	10	3k54_1N1_A_1 PDB CREDO	0.569	0.218	0.508	0.010
Rv0848.1	10	3qlg_1N1_A_601 PDB CREDO	0.508	0.305	0.508	0.010
Rv0848.1	10	3bl1_BL1_A_300 PDB CREDO	0.528	0.276	0.508	0.010
Rv0848.1	12	3kk6_CEL_B_1701 PDB CREDO	0.671	0.105	0.508	0.010
Rv0848.1	10	1fj8_CER_B_500 PDB CREDO	0.597	0.183	0.508	0.010
Rv0848.1	10	3g1u_ADN_B_438 PDB CREDO	0.528	0.276	0.508	0.010
Rv0848.1	10	3g5d_1N1_B_1 PDB CREDO	0.508	0.307	0.508	0.010
Rv0848.1	12	1uwj_BAX_B_1723 PDB CREDO	0.795	0.027	0.507	0.010
Rv0848.1	10	1ict_T44_D_129 PDB CREDO	0.526	0.278	0.506	0.010
Rv0848.1	12	2hyy_STI_A_600 PDB CREDO	0.747	0.049	0.505	0.010
Rv0848.1	12	3ms9_STI_A_1 PDB CREDO	0.747	0.049	0.505	0.010
Rv0848.1	10	1ie4_T44_A_128 PDB CREDO	0.570	0.217	0.505	0.010
Rv0848.1	10	1uho_VDN_A_1000 PDB CREDO	0.594	0.186	0.505	0.010
Rv0848.1	10	2cbr_A80_A_201 PDB CREDO	0.545	0.251	0.505	0.010
Rv0848.1	12	1iep_STI_A_201 PDB CREDO	0.747	0.050	0.505	0.010
Rv0848.1	12	1skx_RFP_A_1 PDB CREDO	0.667	0.108	0.505	0.010
Rv0848.1	10	3g5d_1N1_A_1 PDB CREDO	0.505	0.311	0.505	0.010
Rv0848.1	12	3pyy_STI_A_3 PDB CREDO	0.745	0.051	0.504	0.010
Rv0848.1	12	3ms9_STI_B_1 PDB CREDO	0.744	0.051	0.503	0.010
Rv0848.1	10	3oht_1N1_A_1000 PDB CREDO	0.543	0.254	0.503	0.010
Rv0848.1	10	2xpv_MIY_A_1209 PDB CREDO	0.606	0.172	0.503	0.010
Rv0848.1	12	3k5v_STI_B_2 PDB CREDO	0.744	0.051	0.503	0.010
Rv0848.1	12	3mss_STI_A_1 PDB CREDO	0.743	0.052	0.503	0.010
Rv0848.1	12	3pyy_STI_B_4 PDB CREDO	0.743	0.052	0.503	0.010
Rv0848.1	10	1mx1_THA_D_4 PDB CREDO	0.522	0.284	0.502	0.011
Rv0848.1	10	2riw_T44_A_1395 PDB CREDO	0.590	0.191	0.502	0.011
Rv0848.1	12	2hyy_STI_D_600 PDB CREDO	0.742	0.052	0.502	0.011
Rv0848.1	12	3nxu_RIT_A_600 PDB CREDO	0.664	0.111	0.502	0.011
Rv0848.1	10	3k2h_LYA_B_514 PDB CREDO	0.604	0.174	0.502	0.011
Rv0848.1	12	3mss_STI_C_1 PDB CREDO	0.742	0.053	0.502	0.011
Rv0848.1	12	3mss_STI_D_1 PDB CREDO	0.741	0.053	0.501	0.011
Rv0848.1	10	1fm6_BRL_D_503 PDB CREDO	0.603	0.175	0.501	0.011
Rv0848.1	10	3g1u_ADN_A_438 PDB CREDO	0.521	0.286	0.501	0.011
Rv0848.1	12	1t7i_017_A_200 PDB CREDO	0.501	0.318	0.501	0.011
Rv0848.1	12	2hyy_STI_C_600 PDB CREDO	0.740	0.054	0.501	0.011
Rv0848.1	10	4e3a_ADN_B_500 PDB CREDO	0.540	0.258	0.500	0.011
Rv0848.1	12	1iep_STI_B_202 PDB CREDO	0.740	0.054	0.500	0.011
Rv0848.1	12	3mss_STI_B_1 PDB CREDO	0.740	0.054	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
O-acetylserinePubChem	0.919	147.129
sulphurPubChem	0.911	34.0809
O-acetyl-L-serinePubChem	0.905	147.129
L-serinePubChem	0.905	105.093
half-cystinePubChem	0.904	121.158
acetyl-CoAPubChem	0.9	809.571
NADP(H)PubChem	0.9	745.421
cysteinatePubChem	0.9	121.158
coenzyme APubChem	0.9	767.534
bisulfitePubChem	0.9	80.0632
H(+)PubChem	0.9	2.01588
deuteriumPubChem	0.9	2.01588
acetatePubChem	0.9	59.044
NADPPubChem	0.9	744.413
acetyl coenzyme-APubChem	0.9	809.571
hydroxyl radicalsPubChem	0.9	17.0073
DL-serinePubChem	0.9	105.093
Co-APubChem	0.9	767.534
protiumPubChem	0.9	2.01576
L-selenocysteinePubChem	0.9	168.053