SInCRe - Rv0234c

Tuberculist information

Gene name	gabD1
Protein function	Succinate-semialdehyde dehydrogenase [NADP+] dependent (SSDH) GabD1
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	279.605
Molecular mass(da)	54299.6
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 511

	  		  	1    MRSVTCSATLVLPVIEPTPADRRPRHLLLGSAGHVSGRLDTGRFVQTHPAKDVSVPIATI   60
			  	61   NPATGETVKTFTAATDDEVDAAIARAHRRFADYRQTSFAQRARWANATADLLEAEADQAA  120
			  	121  AMMTLEMGKTLAAAKAEALKCAKGFRYYAENAEALLADEPADAAKVGASAAYGRYQPLGV  180
			  	181  ILAVMPWNFPLWQAVRFAAPALMAGNVGLLKHASNVPQCALYLADVIARGGFPDGCFQTL  240
			  	241  LVSSGAVEAILRDPRVAAATLTGSEPAGQSVGAIAGNEIKPTVLELGGSDPFIVMPSADL  300
			  	301  DAAVSTAVTGRVQNNGQSCIAAKRFIVHADIYDDFVDKFVARMAALRVGDPTDPDTDVGP  360
			  	361  LATEQGRNEVAKQVEDAAAAGAVIRCGGKRLDRPGWFYPPTVITDISKDMALYTEEVFGP  420
			  	421  VASVFRAANIDEAVEIANATTFGLGSNAWTRDETEQRRFIDDIVAGQVFINGMTVSYPEL  480
			  	481  PFGGVKRSGYGRELSAHGIREFCNIKTVWIA

Known structures in the PDB

No Known structures

Number of amino acids : 511

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Aldedh	PF00171	48-508

Mtb Structural Proteome models

Model Number	1
Model name	Rv0234c
Template	1WND APDB CREDO
Template coverage	1_473
Template Identity(%)	33.0
Model coverage(%)	93.2
Normalized DOPE score	-0.447

Model Number	2
Model name	Rv0234c.1
Template	2BHQ APDB CREDO
Template coverage	1_512
Template Identity(%)	26.5
Model coverage(%)	98.6
Normalized DOPE score	-0.235

Structure Models from Chopin

Model Number	1
Profile	c.82.1.1 Click for model details
zscore	59.36
Residue begin	1
Residue end	511

Model Number	2
Profile	3.40.309.10 Click for model details
zscore	40.24
Residue begin	285
Residue end	491

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0234c	Gene name	Confidence Score
Rv2589	gabT	0.957
Rv3318	sdhA	0.906
Rv3318	sdhA	0.906
Rv1552	frdA	0.903
Rv1552	frdA	0.903
Rv1553	frdB	0.901
Rv1553	frdB	0.901

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0234c.1	19	2xkw_P1B_B_1475 PDB CREDO	0.643	0.132	0.620	0.001
Rv0234c.1	19	1s9p_DES_A_459 PDB CREDO	0.618	0.158	0.618	0.001
Rv0234c.1	19	3oht_1N1_B_1000 PDB CREDO	0.608	0.170	0.608	0.002
Rv0234c.1	19	1s9p_DES_D_600 PDB CREDO	0.603	0.176	0.603	0.002
Rv0234c.1	19	3erd_DES_A_600 PDB CREDO	0.618	0.158	0.596	0.002
Rv0234c.1	19	3erd_DES_B_800 PDB CREDO	0.618	0.159	0.596	0.002
Rv0234c.1	19	1fm6_BRL_D_503 PDB CREDO	0.595	0.185	0.595	0.002
Rv0234c.1	19	3qt0_486_A_4 PDB CREDO	0.638	0.137	0.595	0.002
Rv0234c.1	19	1bsx_T3_A_1 PDB CREDO	0.705	0.077	0.595	0.002
Rv0234c.1	19	1bsx_T3_B_2 PDB CREDO	0.705	0.077	0.595	0.002
Rv0234c.1	19	2prg_BRL_A_1 PDB CREDO	0.593	0.188	0.593	0.002
Rv0234c.1	19	2h77_T3_A_1 PDB CREDO	0.655	0.119	0.591	0.002
Rv0234c.1	19	3gws_T3_X_500 PDB CREDO	0.697	0.083	0.588	0.003
Rv0234c.1	19	1zgy_BRL_A_503 PDB CREDO	0.647	0.127	0.584	0.003
Rv0234c.1	19	3uvv_T3_A_501 PDB CREDO	0.714	0.071	0.583	0.003
Rv0234c.1	19	1xzx_T3_X_500 PDB CREDO	0.712	0.072	0.582	0.003
Rv0234c.1	19	2h79_T3_A_1 PDB CREDO	0.660	0.114	0.576	0.003
Rv0234c.1	19	3oht_1N1_A_1000 PDB CREDO	0.641	0.134	0.575	0.003
Rv0234c.1	19	2cbr_A80_A_201 PDB CREDO	0.640	0.134	0.574	0.003
Rv0234c.1	19	2fum_MIX_D_3539 PDB CREDO	0.602	0.177	0.561	0.004
Rv0234c.1	1	2v0z_C41_C_1328 PDB CREDO	0.693	0.086	0.559	0.004
Rv0234c.1	19	3h0a_9RA_A_500 PDB CREDO	0.598	0.182	0.558	0.004
Rv0234c.1	19	3ln1_CEL_D_682 PDB CREDO	0.596	0.184	0.556	0.005
Rv0234c.1	1	3prs_RIT_A_1001 PDB CREDO	0.654	0.121	0.555	0.005
Rv0234c.1	19	1gs4_ZK5_A_1918 PDB CREDO	0.573	0.212	0.553	0.005
Rv0234c.1	19	2prg_BRL_B_2 PDB CREDO	0.551	0.243	0.551	0.005
Rv0234c.1	19	1s9p_DES_B_459 PDB CREDO	0.687	0.091	0.549	0.005
Rv0234c.1	19	1s9p_DES_C_500 PDB CREDO	0.687	0.091	0.549	0.005
Rv0234c.1	19	3bbt_FMM_D_91 PDB CREDO	0.588	0.193	0.549	0.005
Rv0234c.1	19	3bbt_FMM_B_91 PDB CREDO	0.634	0.141	0.547	0.005
Rv0234c.1	19	3oct_1N1_A_663 PDB CREDO	0.566	0.222	0.547	0.005
Rv0234c.1	19	2yja_EST_B_1550 PDB CREDO	0.710	0.073	0.545	0.005
Rv0234c.1	19	3ols_EST_A_600 PDB CREDO	0.709	0.074	0.544	0.006
Rv0234c.1	1	2v0z_C41_O_1327 PDB CREDO	0.726	0.062	0.542	0.006
Rv0234c.1	2	3o0q_ADN_B_1004 PDB CREDO	0.542	0.255	0.542	0.006
Rv0234c.1	19	3ols_EST_B_600 PDB CREDO	0.706	0.076	0.542	0.006
Rv0234c.1	19	1g50_EST_A_600 PDB CREDO	0.705	0.077	0.541	0.006
Rv0234c.1	19	3spk_TPV_A_100 PDB CREDO	0.600	0.179	0.541	0.006
Rv0234c.1	19	3uud_EST_A_600 PDB CREDO	0.704	0.077	0.541	0.006
Rv0234c.1	19	3uud_EST_B_600 PDB CREDO	0.704	0.077	0.541	0.006
Rv0234c.1	3	2ceo_T44_B_1395 PDB CREDO	0.540	0.258	0.540	0.006
Rv0234c.1	3	2ceo_T44_A_1395 PDB CREDO	0.539	0.259	0.539	0.006
Rv0234c.1	38	3znc_BZ1_A_500 PDB CREDO	0.537	0.262	0.537	0.006
Rv0234c.1	19	1mx1_THA_C_3 PDB CREDO	0.537	0.263	0.537	0.006
Rv0234c.1	2	3o0q_ADN_A_1004 PDB CREDO	0.536	0.264	0.536	0.006
Rv0234c.1	19	3qlg_1N1_A_601 PDB CREDO	0.645	0.130	0.536	0.006
Rv0234c.1	19	3qlg_1N1_B_601 PDB CREDO	0.645	0.130	0.536	0.006
Rv0234c.1	19	3hec_STI_A_1 PDB CREDO	0.675	0.101	0.535	0.006
Rv0234c.1	38	1fr6_AZR_B_362 PDB CREDO	0.533	0.268	0.533	0.007
Rv0234c.1	19	3g5d_1N1_B_1 PDB CREDO	0.642	0.133	0.533	0.007
Rv0234c.1	19	1y0x_T44_X_500 PDB CREDO	0.716	0.069	0.533	0.007
Rv0234c.1	3	1pbc_BHA_A_396 PDB CREDO	0.557	0.235	0.532	0.007
Rv0234c.1	19	1qkn_RAL_A_600 PDB CREDO	0.629	0.146	0.531	0.007
Rv0234c.1	19	2fum_MIX_A_539 PDB CREDO	0.550	0.244	0.531	0.007
Rv0234c.1	19	3k54_1N1_A_1 PDB CREDO	0.570	0.216	0.531	0.007
Rv0234c.1	19	3g5d_1N1_A_1 PDB CREDO	0.637	0.137	0.529	0.007
Rv0234c.1	3	2bxg_IBP_B_2001 PDB CREDO	0.553	0.240	0.529	0.007
Rv0234c.1	19	1fm6_BRL_X_504 PDB CREDO	0.647	0.127	0.529	0.007
Rv0234c.1	19	2zva_1N1_A_513 PDB CREDO	0.662	0.113	0.529	0.007
Rv0234c.1	19	2y6o_1N1_A_1892 PDB CREDO	0.644	0.130	0.526	0.007
Rv0234c.1	38	1fr6_AZR_A_362 PDB CREDO	0.526	0.278	0.526	0.007
Rv0234c.1	3	1fj8_CER_A_500 PDB CREDO	0.573	0.213	0.526	0.007
Rv0234c.1	3	1fj8_CER_D_500 PDB CREDO	0.573	0.213	0.526	0.007
Rv0234c.1	19	3heg_BAX_A_1 PDB CREDO	0.728	0.061	0.526	0.007
Rv0234c.1	19	3gcs_BAX_A_401 PDB CREDO	0.749	0.049	0.525	0.007
Rv0234c.1	38	3hku_TOR_A_300 PDB CREDO	0.565	0.224	0.524	0.008
Rv0234c.1	19	1mx1_THA_E_5 PDB CREDO	0.563	0.226	0.524	0.008
Rv0234c.1	19	4asd_BAX_A_1500 PDB CREDO	0.747	0.049	0.524	0.008
Rv0234c.1	19	2gqg_1N1_A_501 PDB CREDO	0.542	0.255	0.523	0.008
Rv0234c.1	3	1fj8_CER_B_500 PDB CREDO	0.570	0.217	0.523	0.008
Rv0234c.1	19	3oez_STI_B_601 PDB CREDO	0.660	0.114	0.523	0.008
Rv0234c.1	3	3czv_AZM_A_263 PDB CREDO	0.523	0.284	0.523	0.008
Rv0234c.1	19	3jwq_VIA_D_901 PDB CREDO	0.560	0.230	0.523	0.008
Rv0234c.1	19	3o1c_ADN_A_127 PDB CREDO	0.560	0.230	0.521	0.008
Rv0234c.1	3	2ydo_ADN_A_400 PDB CREDO	0.521	0.286	0.521	0.008
Rv0234c.1	3	3mdv_CL6_A_506 PDB CREDO	0.570	0.217	0.521	0.008
Rv0234c.1	3	3mdz_EZL_A_264 PDB CREDO	0.542	0.255	0.519	0.008
Rv0234c.1	19	3cs8_BRL_A_503 PDB CREDO	0.649	0.126	0.518	0.008
Rv0234c.1	3	1fj8_CER_C_500 PDB CREDO	0.564	0.224	0.518	0.008
Rv0234c.1	14	1d4f_ADN_C_603 PDB CREDO	0.536	0.263	0.518	0.008
Rv0234c.1	19	3jwq_VIA_B_901 PDB CREDO	0.536	0.264	0.517	0.008
Rv0234c.1	19	2hw2_RFP_A_1200 PDB CREDO	0.653	0.122	0.517	0.008
Rv0234c.1	38	1zgf_TRU_A_300 PDB CREDO	0.515	0.295	0.515	0.009
Rv0234c.1	2	1bx4_ADN_A_355 PDB CREDO	0.542	0.255	0.514	0.009
Rv0234c.1	19	3adx_IMN_B_3 PDB CREDO	0.669	0.107	0.513	0.009
Rv0234c.1	19	1sqn_NDR_A_1001 PDB CREDO	0.513	0.299	0.513	0.009
Rv0234c.1	19	2uxo_TAC_B_1211 PDB CREDO	0.668	0.108	0.513	0.009
Rv0234c.1	19	3qgz_ADN_A_127 PDB CREDO	0.551	0.243	0.513	0.009
Rv0234c.1	19	4eb6_VLB_C_503 PDB CREDO	0.531	0.271	0.513	0.009
Rv0234c.1	3	3r9c_ECL_A_452 PDB CREDO	0.558	0.232	0.512	0.009
Rv0234c.1	38	3g1u_ADN_D_438 PDB CREDO	0.512	0.299	0.512	0.009
Rv0234c.1	3	3nrr_D16_A_520 PDB CREDO	0.512	0.300	0.512	0.009
Rv0234c.1	38	2c49_ADN_A_1301 PDB CREDO	0.532	0.270	0.512	0.009
Rv0234c.1	19	4eyb_0WO_A_303 PDB CREDO	0.511	0.301	0.511	0.009
Rv0234c.1	3	1kvl_CLS_A_371 PDB CREDO	0.534	0.266	0.511	0.009
Rv0234c.1	19	2jfa_RAL_A_600 PDB CREDO	0.645	0.129	0.511	0.009
Rv0234c.1	19	1sqn_NDR_B_2001 PDB CREDO	0.511	0.302	0.511	0.009
Rv0234c.1	38	2pou_I7A_A_1000 PDB CREDO	0.510	0.303	0.510	0.009
Rv0234c.1	19	2j7y_E3O_A_1454 PDB CREDO	0.590	0.191	0.509	0.009
Rv0234c.1	19	1jg2_ADN_A_500 PDB CREDO	0.527	0.277	0.509	0.010
Rv0234c.1	38	3bl1_BL1_A_300 PDB CREDO	0.509	0.305	0.509	0.010
Rv0234c.1	19	2jfa_RAL_B_600 PDB CREDO	0.663	0.112	0.509	0.010
Rv0234c.1	38	1i2w_CFX_B_2300 PDB CREDO	0.571	0.215	0.508	0.010
Rv0234c.1	19	1err_RAL_A_600 PDB CREDO	0.662	0.113	0.508	0.010
Rv0234c.1	3	1ki3_PE2_B_2 PDB CREDO	0.507	0.307	0.507	0.010
Rv0234c.1	38	3g1u_ADN_B_438 PDB CREDO	0.547	0.248	0.507	0.010
Rv0234c.1	19	1mx1_THA_D_4 PDB CREDO	0.634	0.141	0.506	0.010
Rv0234c.1	19	3ln1_CEL_A_682 PDB CREDO	0.600	0.179	0.506	0.010
Rv0234c.1	38	3sv9_SV6_A_1 PDB CREDO	0.506	0.309	0.506	0.010
Rv0234c.1	19	3lfa_1N1_A_361 PDB CREDO	0.715	0.070	0.506	0.010
Rv0234c.1	19	1err_RAL_B_600 PDB CREDO	0.659	0.116	0.505	0.010
Rv0234c.1	3	3k2h_LYA_A_514 PDB CREDO	0.647	0.127	0.505	0.010
Rv0234c.1	19	3ln1_CEL_B_682 PDB CREDO	0.598	0.181	0.505	0.010
Rv0234c.1	38	1i2w_CFX_A_1300 PDB CREDO	0.567	0.220	0.504	0.010
Rv0234c.1	19	3ln1_CEL_C_682 PDB CREDO	0.597	0.182	0.504	0.010
Rv0234c.1	19	2oiq_STI_A_1001 PDB CREDO	0.697	0.083	0.503	0.010
Rv0234c.1	3	3sxr_1N1_B_2 PDB CREDO	0.593	0.187	0.501	0.011
Rv0234c.1	14	3tne_RIT_B_401 PDB CREDO	0.656	0.119	0.501	0.011
Rv0234c.1	38	3g1u_ADN_A_438 PDB CREDO	0.541	0.256	0.501	0.011
Rv0234c.1	3	1jlf_NVP_A_999 PDB CREDO	0.523	0.283	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
succinic semialdehydePubChem	0.974	102.089
succinatePubChem	0.958	118.088
NADPPubChem	0.71	744.413