SInCRe - Rv3372

Tuberculist information

Gene name	otsB2
Protein function	Trehalose 6-phosphate phosphatase OtsB2 (trehalose-phosphatase) (TPP)
Functional category(tuberculist)	virulence,detoxification and adaptaion
Gene location(kb)	3786.31
Molecular mass(da)	41688.2
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 391

	  		  	1    VRKLGPVTIDPRRHDAVLFDTTLDATQELVRQLQEVGVGTGVFGSGLDVPIVAAGRLAVR   60
			  	61   PGRCVVVSAHSAGVTAARESGFALIIGVDRTGCRDALRRDGADTVVTDLSEVSVRTGDRR  120
			  	121  MSQLPDALQALGLADGLVARQPAVFFDFDGTLSDIVEDPDAAWLAPGALEALQKLAARCP  180
			  	181  IAVLSGRDLADVTQRVGLPGIWYAGSHGFELTAPDGTHHQNDAAAAAIPVLKQAAAELRQ  240
			  	241  QLGPFPGVVVEHKRFGVAVHYRNAARDRVGEVAAAVRTAEQRHALRVTTGREVIELRPDV  300
			  	301  DWDKGKTLLWVLDHLPHSGSAPLVPIYLGDDITDEDAFDVVGPHGVPIVVRHTDDGDRAT  360
			  	361  AALFALDSPARVAEFTDRLARQLREAPLRAT

Known structures in the PDB

No Known structures

Number of amino acids : 391

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Trehalose_PPase	PF02358	145-370

Mtb Structural Proteome models

Model Number	1
Model name	Rv3372
Template	1U02 APDB CREDO
Template coverage	4_220
Template Identity(%)	24.0
Model coverage(%)	59.6
Normalized DOPE score	-0.337

Model Number	2
Model name	Rv3372.1
Template	1O08 APDB CREDO
Template coverage	1109_1193
Template Identity(%)	17.6
Model coverage(%)	22.8
Normalized DOPE score	0.345

Structure Models from Chopin

Model Number	1
Profile	c.108.1.15 Click for model details
zscore	34.32
Residue begin	142
Residue end	387

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3372	Gene name	Confidence Score
Rv3490	otsA	0.999
Rv2006	otsB1	0.971
Rv2006	otsB1	0.971
Rv2006	otsB1	0.971
Rv2006	otsB1	0.971
Rv2006	otsB1	0.971
Rv0126	treS	0.954
Rv0126	treS	0.954
Rv1563c	treY	0.906

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3372.1	4	3lfa_1N1_A_361 PDB CREDO	0.731	0.059	0.642	0.001
Rv3372.1	4	3ads_IMN_B_3 PDB CREDO	0.696	0.084	0.637	0.001
Rv3372.1	4	1uay_ADN_A_1001 PDB CREDO	0.637	0.137	0.609	0.002
Rv3372.1	4	3ug2_IRE_A_1 PDB CREDO	0.734	0.057	0.608	0.002
Rv3372.1	4	1sn0_T44_C_601 PDB CREDO	0.599	0.180	0.599	0.002
Rv3372.1	5	3r9c_ECL_A_451 PDB CREDO	0.688	0.090	0.592	0.002
Rv3372.1	4	1ere_EST_E_600 PDB CREDO	0.618	0.158	0.591	0.002
Rv3372.1	4	1ere_EST_A_600 PDB CREDO	0.617	0.159	0.590	0.003
Rv3372.1	4	3hm1_J3Z_A_2 PDB CREDO	0.616	0.160	0.589	0.003
Rv3372.1	4	1r9o_FLP_A_501 PDB CREDO	0.613	0.164	0.586	0.003
Rv3372.1	4	1ere_EST_B_600 PDB CREDO	0.612	0.165	0.585	0.003
Rv3372.1	4	1xbb_STI_A_1 PDB CREDO	0.706	0.076	0.585	0.003
Rv3372.1	4	1pcg_EST_B_2 PDB CREDO	0.611	0.166	0.584	0.003
Rv3372.1	4	1qku_EST_B_600 PDB CREDO	0.609	0.169	0.582	0.003
Rv3372.1	4	1qku_EST_A_600 PDB CREDO	0.607	0.171	0.580	0.003
Rv3372.1	4	1qku_EST_C_600 PDB CREDO	0.606	0.172	0.579	0.003
Rv3372.1	4	1g50_EST_B_1600 PDB CREDO	0.604	0.175	0.577	0.003
Rv3372.1	4	2yja_EST_B_1550 PDB CREDO	0.707	0.075	0.571	0.004
Rv3372.1	4	3ols_EST_B_600 PDB CREDO	0.707	0.075	0.571	0.004
Rv3372.1	4	3ols_EST_A_600 PDB CREDO	0.705	0.077	0.570	0.004
Rv3372.1	4	1sn5_T3_D_602 PDB CREDO	0.570	0.217	0.570	0.004
Rv3372.1	4	1g50_EST_A_600 PDB CREDO	0.704	0.078	0.569	0.004
Rv3372.1	4	3bbt_FMM_B_91 PDB CREDO	0.791	0.028	0.568	0.004
Rv3372.1	4	1gwr_EST_B_600 PDB CREDO	0.594	0.186	0.568	0.004
Rv3372.1	4	1gwr_EST_A_600 PDB CREDO	0.593	0.187	0.567	0.004
Rv3372.1	4	2uxp_CLM_B_1211 PDB CREDO	0.593	0.187	0.567	0.004
Rv3372.1	4	2j7x_EST_A_1454 PDB CREDO	0.618	0.158	0.566	0.004
Rv3372.1	4	3uud_EST_A_600 PDB CREDO	0.700	0.081	0.566	0.004
Rv3372.1	4	2ocf_EST_A_596 PDB CREDO	0.614	0.162	0.562	0.004
Rv3372.1	4	3uud_EST_B_600 PDB CREDO	0.694	0.086	0.561	0.004
Rv3372.1	4	1ere_EST_F_600 PDB CREDO	0.611	0.166	0.560	0.004
Rv3372.1	4	3hm1_J3Z_B_1 PDB CREDO	0.611	0.166	0.560	0.004
Rv3372.1	4	1ere_EST_C_600 PDB CREDO	0.610	0.167	0.559	0.004
Rv3372.1	4	1ere_EST_D_600 PDB CREDO	0.609	0.168	0.558	0.004
Rv3372.1	5	2w03_ADN_A_1588 PDB CREDO	0.683	0.095	0.557	0.004
Rv3372.1	4	1g50_EST_C_2600 PDB CREDO	0.608	0.169	0.557	0.004
Rv3372.1	4	1mx1_THA_A_1 PDB CREDO	0.634	0.140	0.557	0.004
Rv3372.1	4	1pcg_EST_A_1 PDB CREDO	0.606	0.172	0.555	0.005
Rv3372.1	4	1qkt_EST_A_600 PDB CREDO	0.606	0.172	0.555	0.005
Rv3372.1	4	3oll_EST_A_600 PDB CREDO	0.606	0.172	0.555	0.005
Rv3372.1	4	3oll_EST_B_600 PDB CREDO	0.605	0.173	0.554	0.005
Rv3372.1	4	3adx_IMN_B_3 PDB CREDO	0.685	0.093	0.553	0.005
Rv3372.1	4	1a52_EST_A_1 PDB CREDO	0.604	0.174	0.553	0.005
Rv3372.1	4	1a52_EST_B_2 PDB CREDO	0.604	0.174	0.553	0.005
Rv3372.1	5	2x7h_PFN_A_1372 PDB CREDO	0.580	0.204	0.553	0.005
Rv3372.1	4	2uxp_CLM_A_1211 PDB CREDO	0.573	0.213	0.547	0.005
Rv3372.1	4	1sn5_T3_C_601 PDB CREDO	0.623	0.152	0.547	0.005
Rv3372.1	4	4dta_ADN_A_401 PDB CREDO	0.546	0.249	0.546	0.005
Rv3372.1	4	1mx1_THA_F_6 PDB CREDO	0.703	0.078	0.546	0.005
Rv3372.1	4	1mx1_THA_B_2 PDB CREDO	0.647	0.127	0.545	0.005
Rv3372.1	4	1ya4_CTX_B_2 PDB CREDO	0.699	0.082	0.543	0.006
Rv3372.1	4	1m17_AQ4_A_999 PDB CREDO	0.644	0.130	0.543	0.006
Rv3372.1	4	1mx1_THA_D_4 PDB CREDO	0.698	0.082	0.542	0.006
Rv3372.1	5	3ug2_IRE_A_1 PDB CREDO	0.568	0.219	0.541	0.006
Rv3372.1	5	3r9c_ECL_A_452 PDB CREDO	0.705	0.077	0.538	0.006
Rv3372.1	4	1ya4_CTX_C_3 PDB CREDO	0.691	0.088	0.536	0.006
Rv3372.1	5	2jap_J01_D_1249 PDB CREDO	0.534	0.266	0.534	0.006
Rv3372.1	4	2itz_IRE_A_2021 PDB CREDO	0.658	0.117	0.531	0.007
Rv3372.1	5	2ij7_TPF_D_2473 PDB CREDO	0.531	0.272	0.531	0.007
Rv3372.1	5	2jap_J01_C_1249 PDB CREDO	0.530	0.273	0.530	0.007
Rv3372.1	5	2jap_J01_B_1249 PDB CREDO	0.528	0.275	0.528	0.007
Rv3372.1	5	2ij7_TPF_A_2472 PDB CREDO	0.527	0.277	0.527	0.007
Rv3372.1	4	2ito_IRE_A_2020 PDB CREDO	0.733	0.058	0.527	0.007
Rv3372.1	5	2ij7_TPF_B_2470 PDB CREDO	0.526	0.278	0.526	0.007
Rv3372.1	4	1ie4_T44_A_128 PDB CREDO	0.624	0.151	0.526	0.007
Rv3372.1	5	2uxp_CLM_A_1211 PDB CREDO	0.577	0.207	0.525	0.007
Rv3372.1	5	2uxp_CLM_B_1211 PDB CREDO	0.576	0.209	0.524	0.008
Rv3372.1	4	2ity_IRE_A_2020 PDB CREDO	0.675	0.101	0.524	0.008
Rv3372.1	5	2ij7_TPF_F_2474 PDB CREDO	0.549	0.245	0.524	0.008
Rv3372.1	5	3ik6_HCZ_B_800 PDB CREDO	0.577	0.208	0.523	0.008
Rv3372.1	4	1s9p_DES_C_500 PDB CREDO	0.673	0.103	0.522	0.008
Rv3372.1	4	1s9p_DES_B_459 PDB CREDO	0.672	0.104	0.522	0.008
Rv3372.1	5	2jap_J01_A_1249 PDB CREDO	0.520	0.287	0.520	0.008
Rv3372.1	5	3s20_CER_A_1 PDB CREDO	0.574	0.211	0.520	0.008
Rv3372.1	5	2bxe_1FL_A_2001 PDB CREDO	0.519	0.289	0.519	0.008
Rv3372.1	4	2zva_1N1_A_513 PDB CREDO	0.666	0.110	0.517	0.008
Rv3372.1	5	2bxe_1FL_B_2001 PDB CREDO	0.516	0.294	0.516	0.009
Rv3372.1	5	3ijx_HCZ_B_800 PDB CREDO	0.569	0.218	0.516	0.009
Rv3372.1	5	3ads_IMN_B_3 PDB CREDO	0.646	0.129	0.514	0.009
Rv3372.1	4	1jg3_ADN_B_550 PDB CREDO	0.687	0.091	0.513	0.009
Rv3372.1	5	3q1e_T44_D_328 PDB CREDO	0.643	0.131	0.512	0.009
Rv3372.1	4	2uxo_TAC_B_1211 PDB CREDO	0.633	0.141	0.512	0.009
Rv3372.1	4	3qlg_1N1_A_601 PDB CREDO	0.685	0.093	0.511	0.009
Rv3372.1	5	3ilt_TRU_E_800 PDB CREDO	0.537	0.263	0.511	0.009
Rv3372.1	5	1r9o_FLP_A_501 PDB CREDO	0.561	0.229	0.511	0.009
Rv3372.1	4	3g5d_1N1_B_1 PDB CREDO	0.684	0.094	0.511	0.009
Rv3372.1	4	3b2r_VDN_B_1 PDB CREDO	0.510	0.303	0.510	0.009
Rv3372.1	5	3s20_CER_B_1 PDB CREDO	0.510	0.303	0.510	0.009
Rv3372.1	4	3oht_1N1_A_1000 PDB CREDO	0.735	0.056	0.509	0.010
Rv3372.1	5	3rf4_FUN_A_201 PDB CREDO	0.562	0.228	0.509	0.010
Rv3372.1	5	3rf4_FUN_C_203 PDB CREDO	0.562	0.228	0.509	0.010
Rv3372.1	4	3qlg_1N1_B_601 PDB CREDO	0.681	0.096	0.508	0.010
Rv3372.1	4	3b2r_VDN_A_1 PDB CREDO	0.507	0.307	0.507	0.010
Rv3372.1	4	3g5d_1N1_A_1 PDB CREDO	0.679	0.098	0.507	0.010
Rv3372.1	5	2nnj_225_A_501 PDB CREDO	0.532	0.270	0.506	0.010
Rv3372.1	5	3ik6_HCZ_B_262 PDB CREDO	0.588	0.193	0.506	0.010
Rv3372.1	4	2nnj_225_A_501 PDB CREDO	0.611	0.166	0.506	0.010
Rv3372.1	4	3vkx_T3_A_301 PDB CREDO	0.582	0.201	0.506	0.010
Rv3372.1	4	3oht_1N1_B_1000 PDB CREDO	0.815	0.019	0.506	0.010
Rv3372.1	4	3sxr_1N1_B_2 PDB CREDO	0.625	0.150	0.505	0.010
Rv3372.1	5	3rf4_FUN_B_202 PDB CREDO	0.558	0.233	0.505	0.010
Rv3372.1	4	3kw2_ADN_B_300 PDB CREDO	0.651	0.124	0.505	0.010
Rv3372.1	4	2bxf_DZP_A_2001 PDB CREDO	0.527	0.276	0.504	0.010
Rv3372.1	4	2fum_MIX_B_1539 PDB CREDO	0.623	0.152	0.504	0.010
Rv3372.1	4	1qhy_CLM_A_999 PDB CREDO	0.605	0.173	0.501	0.011
Rv3372.1	5	1sn0_T44_C_601 PDB CREDO	0.576	0.209	0.501	0.011
Rv3372.1	4	3bbt_FMM_D_91 PDB CREDO	0.865	0.008	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
trehalosePubChem	0.978	342.296
trehalose-6-phosphatePubChem	0.977	422.276
glucose-6-phosphatePubChem	0.937	260.136
GDP-glucosePubChem	0.911	605.341
GDP-mannosePubChem	0.906	605.341
phosphatePubChem	0.901	96.9872
neotrehalosePubChem	0.9	342.296
hydroxyl radicalsPubChem	0.9	17.0073
protiumPubChem	0.9	2.01576
guanosine diphosphatePubChem	0.9	443.201
H(+)PubChem	0.9	2.01588
deuteriumPubChem	0.9	2.01588
alpha-D-glucose 6-phosphatePubChem	0.9	260.136
GDP-D-glucose dianionPubChem	0.9	605.341