SInCRe - Rv3285

Tuberculist information

Gene name	accA3
Protein function	Probable bifunctional protein acetyl-/propionyl-coenzyme A carboxylase (alpha chain) AccA3: biotin carboxylase + biotin carboxyl carrier protein (BCCP)
Functional category(tuberculist)	lipid metabolism
Gene location(kb)	3666.36
Molecular mass(da)	63751
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 600

	  		  	1    VASHAGSRIARISKVLVANRGEIAVRVIRAARDAGLPSVAVYAEPDAESPHVRLADEAFA   60
			  	61   LGGQTSAESYLDFAKILDAAAKSGANAIHPGYGFLAENADFAQAVIDAGLIWIGPSPQSI  120
			  	121  RDLGDKVTARHIAARAQAPLVPGTPDPVKGADEVVAFAEEYGLPIAIKAAHGGGGKGMKV  180
			  	181  ARTIDEIPELYESAVREATAAFGRGECYVERYLDKPRHVEAQVIADQHGNVVVAGTRDCS  240
			  	241  LQRRYQKLVEEAPAPFLTDFQRKEIHDSAKRICKEAHYHGAGTVEYLVGQDGLISFLEVN  300
			  	301  TRLQVEHPVTEETAGIDLVLQQFRIANGEKLDITEDPTPRGHAIEFRINGEDAGRNFLPA  360
			  	361  PGPVTKFHPPSGPGVRVDSGVETGSVIGGQFDSMLAKLIVHGADRAEALARARRALNEFG  420
			  	421  VEGLATVIPFHRAVVSDPAFIGDANGFSVHTRWIETEWNNTIEPFTDGEPLDEDARPRQK  480
			  	481  VVVEIDGRRVEVSLPADLALSNGGGCDPVGVIRRKPKPRKRGAHTGAAASGDAVTAPMQG  540
			  	541  TVVKFAVEEGQEVVAGDLVVVLEAMKMENPVTAHKDGTITGLAVEAGAAITQGTVLAEIK  600

Known structures in the PDB

No Known structures

Number of amino acids : 600

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
CPSase_L_chain	PF00289	11-120
CPSase_L_D2	PF02786	125-334
Biotin_carb_C	PF02785	345-455
Biotin_lipoyl	PF00364	532-599

Mtb Structural Proteome models

Model Number	1
Model name	Rv3285
Template	1ULZ APDB CREDO
Template coverage	2_451
Template Identity(%)	42.9
Model coverage(%)	75.8
Normalized DOPE score	-0.637

Model Number	2
Model name	Rv3285.3
Template	2D5D APDB CREDO
Template coverage	77_145
Template Identity(%)	39.1
Model coverage(%)	11.3
Normalized DOPE score	-0.584

Model Number	3
Model name	Rv3285.1
Template	1A9X APDB CREDO
Template coverage	2_633
Template Identity(%)	14.5
Model coverage(%)	98.8
Normalized DOPE score	1.031

Structure Models from Chopin

Model Number	1
Profile	3.30.1490.20, 3.30.470.20 Click for model details
zscore	64.02
Residue begin	1
Residue end	457

Model Number	2
Profile	d.142.1.2 Click for model details
zscore	25.18
Residue begin	125
Residue end	334

Model Number	3
Profile	d.142.1.2 Click for model details
zscore	15.13
Residue begin	124
Residue end	417

Model Number	4
Profile	b.84.1.1 - 2.40.50.100 Click for model details
zscore	14.17
Residue begin	518
Residue end	600

Model Number	5
Profile	c.30.1.5, d.142.1.3 - 3.30.1490.20, 3.30.470.20, 3.40.50.20 Click for model details
zscore	13.98
Residue begin	10
Residue end	328

Model Number	6
Profile	c.30.1.1 Click for model details
zscore	12.78
Residue begin	2
Residue end	128

Model Number	7
Profile	3.30.1490.20 Click for model details
zscore	12.25
Residue begin	133
Residue end	234

Model Number	8
Profile	3.30.470.20 Click for model details
zscore	11.74
Residue begin	181
Residue end	346

Model Number	9
Profile	b.84.2.1 Click for model details
zscore	10.49
Residue begin	345
Residue end	455

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3285	Gene name	Confidence Score
Rv0904c	accD3	0.997
Rv3280	accD5	0.997
Rv3799c	accD4	0.989
Rv2243	fabD	0.985
Rv3279c	birA	0.982
Rv3279c	birA	0.982
Rv2244	acpM	0.975
Rv2502c	accD1	0.951
Rv0533c	fabH	0.93
Rv0533c	fabH	0.93
Rv0533c	fabH	0.93
Rv2247	accD6	0.927
Rv3281	accE5	0.919

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3285.1	49	1sa1_POD_B_700 PDB CREDO	0.688	0.090	0.688	0.000
Rv3285.1	49	1sa1_POD_D_701 PDB CREDO	0.701	0.080	0.681	0.000
Rv3285.1	12	1t46_STI_A_3 PDB CREDO	0.731	0.059	0.637	0.001
Rv3285.1	12	4asd_BAX_A_1500 PDB CREDO	0.695	0.085	0.637	0.001
Rv3285.1	12	1uwj_BAX_A_1723 PDB CREDO	0.635	0.140	0.635	0.001
Rv3285.1	49	3so9_017_A_100 PDB CREDO	0.668	0.107	0.629	0.001
Rv3285.1	49	3h52_486_B_1 PDB CREDO	0.645	0.129	0.626	0.001
Rv3285.1	49	3e22_LOC_B_700 PDB CREDO	0.706	0.076	0.625	0.001
Rv3285.1	49	3e22_LOC_D_700 PDB CREDO	0.705	0.077	0.624	0.001
Rv3285.1	49	3spk_TPV_B_100 PDB CREDO	0.640	0.134	0.622	0.001
Rv3285.1	49	1n49_RIT_D_401 PDB CREDO	0.655	0.119	0.618	0.001
Rv3285.1	12	3spk_TPV_B_100 PDB CREDO	0.653	0.121	0.616	0.002
Rv3285.1	49	3h52_486_D_2 PDB CREDO	0.655	0.120	0.616	0.002
Rv3285.1	49	3bbt_FMM_D_91 PDB CREDO	0.813	0.020	0.611	0.002
Rv3285.1	49	2nni_MTK_A_501 PDB CREDO	0.625	0.150	0.607	0.002
Rv3285.1	12	3oez_STI_A_601 PDB CREDO	0.619	0.156	0.602	0.002
Rv3285.1	19	2y7j_B49_C_1294 PDB CREDO	0.601	0.178	0.601	0.002
Rv3285.1	12	1n49_RIT_D_401 PDB CREDO	0.614	0.163	0.596	0.002
Rv3285.1	49	4asd_BAX_A_1500 PDB CREDO	0.594	0.186	0.594	0.002
Rv3285.1	12	1uwj_BAX_B_1723 PDB CREDO	0.647	0.127	0.594	0.002
Rv3285.1	49	3ut5_LOC_B_502 PDB CREDO	0.630	0.145	0.593	0.002
Rv3285.1	49	3h52_486_A_3 PDB CREDO	0.629	0.146	0.592	0.002
Rv3285.1	49	1uwh_BAX_A_1723 PDB CREDO	0.628	0.148	0.591	0.002
Rv3285.1	12	3pyy_STI_A_3 PDB CREDO	0.607	0.170	0.590	0.003
Rv3285.1	49	1uwh_BAX_B_1723 PDB CREDO	0.627	0.149	0.590	0.003
Rv3285.1	12	2hyy_STI_D_600 PDB CREDO	0.607	0.171	0.590	0.003
Rv3285.1	49	2w8y_486_A_1000 PDB CREDO	0.589	0.193	0.589	0.003
Rv3285.1	12	2hyy_STI_A_600 PDB CREDO	0.605	0.173	0.588	0.003
Rv3285.1	12	3mss_STI_B_1 PDB CREDO	0.605	0.174	0.588	0.003
Rv3285.1	12	3pyy_STI_B_4 PDB CREDO	0.605	0.174	0.588	0.003
Rv3285.1	12	3gp0_NIL_A_1 PDB CREDO	0.692	0.087	0.587	0.003
Rv3285.1	12	3k5v_STI_B_2 PDB CREDO	0.604	0.174	0.587	0.003
Rv3285.1	49	2oax_SNL_F_6001 PDB CREDO	0.605	0.173	0.587	0.003
Rv3285.1	49	3ut5_LOC_D_502 PDB CREDO	0.663	0.112	0.586	0.003
Rv3285.1	49	2oax_SNL_D_4001 PDB CREDO	0.604	0.174	0.586	0.003
Rv3285.1	12	3gvu_STI_A_1001 PDB CREDO	0.602	0.176	0.586	0.003
Rv3285.1	12	2hyy_STI_C_600 PDB CREDO	0.602	0.177	0.585	0.003
Rv3285.1	12	3mss_STI_C_1 PDB CREDO	0.602	0.177	0.585	0.003
Rv3285.1	12	1iep_STI_A_201 PDB CREDO	0.602	0.177	0.585	0.003
Rv3285.1	12	3mss_STI_D_1 PDB CREDO	0.601	0.177	0.584	0.003
Rv3285.1	49	1jg2_ADN_A_500 PDB CREDO	0.805	0.023	0.584	0.003
Rv3285.1	49	3heg_BAX_A_1 PDB CREDO	0.602	0.177	0.584	0.003
Rv3285.1	19	2y7j_B49_D_1294 PDB CREDO	0.705	0.077	0.584	0.003
Rv3285.1	12	1uwh_BAX_A_1723 PDB CREDO	0.676	0.100	0.584	0.003
Rv3285.1	49	2oax_SNL_A_1001 PDB CREDO	0.601	0.178	0.583	0.003
Rv3285.1	12	3ms9_STI_A_1 PDB CREDO	0.600	0.179	0.583	0.003
Rv3285.1	49	2oax_SNL_E_5001 PDB CREDO	0.601	0.178	0.583	0.003
Rv3285.1	12	1uwh_BAX_B_1723 PDB CREDO	0.675	0.101	0.583	0.003
Rv3285.1	12	3mss_STI_A_1 PDB CREDO	0.600	0.179	0.583	0.003
Rv3285.1	12	1n49_RIT_B_301 PDB CREDO	0.616	0.161	0.582	0.003
Rv3285.1	12	3el0_1UN_A_201 PDB CREDO	0.599	0.180	0.582	0.003
Rv3285.1	12	1iep_STI_B_202 PDB CREDO	0.599	0.180	0.582	0.003
Rv3285.1	12	3el9_DR7_A_100 PDB CREDO	0.649	0.125	0.581	0.003
Rv3285.1	12	1xkk_FMM_A_91 PDB CREDO	0.702	0.079	0.581	0.003
Rv3285.1	12	3ms9_STI_B_1 PDB CREDO	0.598	0.182	0.581	0.003
Rv3285.1	12	3k5v_STI_A_2 PDB CREDO	0.597	0.183	0.580	0.003
Rv3285.1	12	1c6y_MK1_B_524 PDB CREDO	0.647	0.127	0.579	0.003
Rv3285.1	19	1xbb_STI_A_1 PDB CREDO	0.579	0.205	0.579	0.003
Rv3285.1	49	3d91_REM_B_350 PDB CREDO	0.579	0.205	0.579	0.003
Rv3285.1	49	1uwj_BAX_B_1723 PDB CREDO	0.579	0.206	0.579	0.003
Rv3285.1	12	1opj_STI_A_3 PDB CREDO	0.611	0.166	0.578	0.003
Rv3285.1	49	2qxs_RAL_A_600 PDB CREDO	0.685	0.093	0.578	0.003
Rv3285.1	49	3d91_REM_A_350 PDB CREDO	0.577	0.207	0.577	0.003
Rv3285.1	12	1opj_STI_B_4 PDB CREDO	0.610	0.167	0.577	0.003
Rv3285.1	49	1n49_RIT_B_301 PDB CREDO	0.665	0.110	0.576	0.003
Rv3285.1	49	3gcs_BAX_A_401 PDB CREDO	0.576	0.208	0.576	0.003
Rv3285.1	49	2qxs_RAL_B_600 PDB CREDO	0.681	0.096	0.574	0.003
Rv3285.1	49	2aoh_FRD_C_305 PDB CREDO	0.590	0.191	0.573	0.003
Rv3285.1	12	2hyy_STI_B_600 PDB CREDO	0.644	0.131	0.573	0.003
Rv3285.1	12	3gcs_BAX_A_401 PDB CREDO	0.624	0.151	0.572	0.003
Rv3285.1	49	2jfa_RAL_B_600 PDB CREDO	0.625	0.151	0.570	0.004
Rv3285.1	12	3heg_BAX_A_1 PDB CREDO	0.641	0.134	0.570	0.004
Rv3285.1	49	1t46_STI_A_3 PDB CREDO	0.713	0.071	0.570	0.004
Rv3285.1	12	2pl0_STI_A_200 PDB CREDO	0.640	0.135	0.569	0.004
Rv3285.1	12	2qxs_RAL_B_600 PDB CREDO	0.618	0.158	0.569	0.004
Rv3285.1	49	1xkk_FMM_A_91 PDB CREDO	0.749	0.048	0.568	0.004
Rv3285.1	49	1uwj_BAX_A_1723 PDB CREDO	0.619	0.157	0.567	0.004
Rv3285.1	49	2aoj_FRD_C_305 PDB CREDO	0.583	0.199	0.566	0.004
Rv3285.1	12	3ekq_ROC_A_100 PDB CREDO	0.615	0.161	0.566	0.004
Rv3285.1	49	1err_RAL_B_600 PDB CREDO	0.619	0.157	0.565	0.004
Rv3285.1	12	1t7j_478_A_200 PDB CREDO	0.655	0.120	0.565	0.004
Rv3285.1	12	3oez_STI_B_601 PDB CREDO	0.697	0.083	0.565	0.004
Rv3285.1	12	3lzv_017_A_200 PDB CREDO	0.581	0.202	0.565	0.004
Rv3285.1	19	1yi4_ADN_A_306 PDB CREDO	0.659	0.116	0.565	0.004
Rv3285.1	49	3ufn_ROC_A_401 PDB CREDO	0.725	0.063	0.565	0.004
Rv3285.1	12	3so9_017_A_100 PDB CREDO	0.654	0.121	0.564	0.004
Rv3285.1	49	1err_RAL_A_600 PDB CREDO	0.617	0.159	0.564	0.004
Rv3285.1	12	2qxs_RAL_A_600 PDB CREDO	0.612	0.165	0.563	0.004
Rv3285.1	2	3uq6_ADN_A_401 PDB CREDO	0.561	0.228	0.561	0.004
Rv3285.1	19	1fb7_ROC_A_100 PDB CREDO	0.730	0.060	0.561	0.004
Rv3285.1	12	3hec_STI_A_1 PDB CREDO	0.691	0.087	0.561	0.004
Rv3285.1	12	3cs9_NIL_A_600 PDB CREDO	0.592	0.189	0.559	0.004
Rv3285.1	12	3cs9_NIL_D_600 PDB CREDO	0.641	0.133	0.559	0.004
Rv3285.1	49	1z2b_VLB_C_800 PDB CREDO	0.576	0.209	0.559	0.004
Rv3285.1	49	2pl0_STI_A_200 PDB CREDO	0.576	0.209	0.559	0.004
Rv3285.1	4	2x1l_ADN_C_601 PDB CREDO	0.559	0.232	0.559	0.004
Rv3285.1	12	3rgf_BAX_A_465 PDB CREDO	0.558	0.233	0.558	0.004
Rv3285.1	12	3ufn_ROC_A_401 PDB CREDO	0.656	0.119	0.557	0.004
Rv3285.1	12	2oiq_STI_A_1001 PDB CREDO	0.626	0.150	0.557	0.004
Rv3285.1	49	2jfa_RAL_A_600 PDB CREDO	0.628	0.147	0.556	0.005
Rv3285.1	49	3sm2_478_A_126 PDB CREDO	0.771	0.037	0.556	0.005
Rv3285.1	49	3ogp_017_A_200 PDB CREDO	0.572	0.215	0.555	0.005
Rv3285.1	12	3cs9_NIL_C_600 PDB CREDO	0.636	0.138	0.555	0.005
Rv3285.1	49	3lzv_017_A_200 PDB CREDO	0.622	0.154	0.554	0.005
Rv3285.1	49	1lhv_NOG_A_301 PDB CREDO	0.645	0.129	0.553	0.005
Rv3285.1	2	3uq6_ADN_B_401 PDB CREDO	0.553	0.240	0.553	0.005
Rv3285.1	49	3spk_TPV_A_100 PDB CREDO	0.710	0.073	0.552	0.005
Rv3285.1	12	3b0w_DGX_B_1 PDB CREDO	0.567	0.221	0.551	0.005
Rv3285.1	12	2y6o_1N1_A_1892 PDB CREDO	0.701	0.080	0.551	0.005
Rv3285.1	12	1sa1_POD_B_700 PDB CREDO	0.601	0.178	0.551	0.005
Rv3285.1	49	3frq_ERY_A_195 PDB CREDO	0.566	0.222	0.549	0.005
Rv3285.1	12	3tne_RIT_A_401 PDB CREDO	0.675	0.102	0.547	0.005
Rv3285.1	12	3v5w_8PR_A_701 PDB CREDO	0.719	0.067	0.547	0.005
Rv3285.1	49	3el0_1UN_A_201 PDB CREDO	0.613	0.163	0.547	0.005
Rv3285.1	6	2oa1_ADN_B_2005 PDB CREDO	0.546	0.249	0.546	0.005
Rv3285.1	12	1c6z_ROC_B_505 PDB CREDO	0.711	0.072	0.545	0.005
Rv3285.1	19	3grv_ADN_A_300 PDB CREDO	0.600	0.179	0.545	0.005
Rv3285.1	6	2fn1_SAL_B_503 PDB CREDO	0.545	0.251	0.545	0.005
Rv3285.1	49	3mno_DEX_A_784 PDB CREDO	0.597	0.183	0.545	0.005
Rv3285.1	49	1a28_STR_B_2 PDB CREDO	0.634	0.140	0.544	0.006
Rv3285.1	49	2ab2_SNL_B_503 PDB CREDO	0.615	0.162	0.544	0.006
Rv3285.1	49	3mnp_DEX_A_784 PDB CREDO	0.595	0.185	0.543	0.006
Rv3285.1	49	2ab2_SNL_A_502 PDB CREDO	0.614	0.163	0.543	0.006
Rv3285.1	19	1pg2_ADN_A_552 PDB CREDO	0.598	0.182	0.543	0.006
Rv3285.1	19	2y7j_B49_A_1294 PDB CREDO	0.626	0.150	0.542	0.006
Rv3285.1	12	3cs9_NIL_B_600 PDB CREDO	0.589	0.193	0.542	0.006
Rv3285.1	49	1c6y_MK1_B_524 PDB CREDO	0.659	0.115	0.541	0.006
Rv3285.1	12	1hwk_117_B_1 PDB CREDO	0.556	0.235	0.540	0.006
Rv3285.1	12	2fxd_DR7_A_102 PDB CREDO	0.603	0.176	0.540	0.006
Rv3285.1	49	3rif_IVM_A_403 PDB CREDO	0.797	0.026	0.539	0.006
Rv3285.1	49	1t7j_478_A_200 PDB CREDO	0.572	0.214	0.539	0.006
Rv3285.1	49	2oiq_STI_A_1001 PDB CREDO	0.555	0.237	0.539	0.006
Rv3285.1	12	1sa1_POD_D_701 PDB CREDO	0.605	0.173	0.538	0.006
Rv3285.1	49	2oax_SNL_C_3001 PDB CREDO	0.608	0.169	0.538	0.006
Rv3285.1	49	3q70_RIT_A_2001 PDB CREDO	0.554	0.238	0.538	0.006
Rv3285.1	6	2fn1_SAL_A_506 PDB CREDO	0.538	0.261	0.538	0.006
Rv3285.1	12	3ogp_017_B_200 PDB CREDO	0.553	0.239	0.538	0.006
Rv3285.1	49	1mx1_THA_C_3 PDB CREDO	0.767	0.039	0.537	0.006
Rv3285.1	12	2nni_MTK_A_501 PDB CREDO	0.568	0.219	0.536	0.006
Rv3285.1	49	2oax_SNL_B_2001 PDB CREDO	0.606	0.172	0.536	0.006
Rv3285.1	4	4dt8_ADN_A_401 PDB CREDO	0.535	0.265	0.535	0.006
Rv3285.1	4	4dta_ADN_A_401 PDB CREDO	0.535	0.265	0.535	0.006
Rv3285.1	49	3rif_IVM_A_402 PDB CREDO	0.791	0.028	0.535	0.006
Rv3285.1	49	2y6o_1N1_A_1892 PDB CREDO	0.623	0.152	0.534	0.006
Rv3285.1	49	3vhu_SNL_A_1001 PDB CREDO	0.604	0.175	0.534	0.006
Rv3285.1	49	3rif_IVM_B_403 PDB CREDO	0.790	0.029	0.534	0.006
Rv3285.1	49	3rif_IVM_D_402 PDB CREDO	0.789	0.029	0.533	0.007
Rv3285.1	49	3tkd_CYZ_B_267 PDB CREDO	0.566	0.221	0.533	0.007
Rv3285.1	12	2r5q_1UN_D_900 PDB CREDO	0.565	0.224	0.533	0.007
Rv3285.1	49	3gp0_NIL_A_1 PDB CREDO	0.683	0.094	0.532	0.007
Rv3285.1	49	3ri5_IVM_C_350 PDB CREDO	0.786	0.030	0.532	0.007
Rv3285.1	12	3ogp_017_A_200 PDB CREDO	0.597	0.183	0.531	0.007
Rv3285.1	49	1jg3_ADN_A_500 PDB CREDO	0.815	0.020	0.531	0.007
Rv3285.1	49	3b0w_DGX_A_1 PDB CREDO	0.531	0.272	0.531	0.007
Rv3285.1	49	3ria_IVM_C_349 PDB CREDO	0.785	0.031	0.531	0.007
Rv3285.1	12	2r5q_1UN_B_900 PDB CREDO	0.562	0.228	0.530	0.007
Rv3285.1	49	3oht_1N1_B_1000 PDB CREDO	0.756	0.045	0.529	0.007
Rv3285.1	49	3oez_STI_A_601 PDB CREDO	0.560	0.230	0.528	0.007
Rv3285.1	49	3tne_RIT_A_401 PDB CREDO	0.597	0.183	0.528	0.007
Rv3285.1	49	2r5q_1UN_D_900 PDB CREDO	0.543	0.254	0.527	0.007
Rv3285.1	49	2r5q_1UN_B_900 PDB CREDO	0.542	0.255	0.526	0.007
Rv3285.1	19	1uay_ADN_A_1001 PDB CREDO	0.607	0.170	0.526	0.007
Rv3285.1	12	1sgu_MK1_B_2632 PDB CREDO	0.541	0.256	0.526	0.007
Rv3285.1	49	2hyy_STI_B_600 PDB CREDO	0.542	0.256	0.526	0.007
Rv3285.1	49	3ekq_ROC_A_100 PDB CREDO	0.623	0.152	0.526	0.007
Rv3285.1	12	3s56_ROC_A_201 PDB CREDO	0.586	0.196	0.525	0.007
Rv3285.1	12	3q70_RIT_A_2001 PDB CREDO	0.590	0.191	0.525	0.007
Rv3285.1	49	3frq_ERY_B_195 PDB CREDO	0.593	0.188	0.525	0.007
Rv3285.1	49	3ogp_017_B_200 PDB CREDO	0.555	0.237	0.524	0.008
Rv3285.1	49	2h42_VIA_A_901 PDB CREDO	0.697	0.083	0.523	0.008
Rv3285.1	12	2q64_1UN_B_1001 PDB CREDO	0.681	0.096	0.523	0.008
Rv3285.1	12	3tkd_CYZ_B_267 PDB CREDO	0.605	0.173	0.522	0.008
Rv3285.1	49	1nhz_486_A_800 PDB CREDO	0.672	0.104	0.522	0.008
Rv3285.1	12	2qak_1UN_A_1001 PDB CREDO	0.679	0.098	0.521	0.008
Rv3285.1	12	2pyn_1UN_A_1001 PDB CREDO	0.678	0.098	0.520	0.008
Rv3285.1	12	3spk_TPV_A_100 PDB CREDO	0.730	0.060	0.520	0.008
Rv3285.1	4	1pg2_ADN_A_552 PDB CREDO	0.569	0.218	0.519	0.008
Rv3285.1	12	2pym_1UN_A_1001 PDB CREDO	0.675	0.101	0.518	0.008
Rv3285.1	12	2jfa_RAL_A_600 PDB CREDO	0.638	0.137	0.518	0.008
Rv3285.1	12	3sm2_478_A_126 PDB CREDO	0.658	0.117	0.517	0.008
Rv3285.1	12	3ogq_AB1_A_200 PDB CREDO	0.641	0.133	0.517	0.008
Rv3285.1	12	2q63_1UN_A_1001 PDB CREDO	0.674	0.102	0.517	0.008
Rv3285.1	12	2jfa_RAL_B_600 PDB CREDO	0.617	0.159	0.516	0.009
Rv3285.1	12	3tne_RIT_B_401 PDB CREDO	0.636	0.138	0.516	0.009
Rv3285.1	49	1p93_DEX_D_4999 PDB CREDO	0.622	0.154	0.516	0.009
Rv3285.1	49	1qkn_RAL_A_600 PDB CREDO	0.621	0.154	0.516	0.009
Rv3285.1	12	3d91_REM_A_350 PDB CREDO	0.562	0.228	0.515	0.009
Rv3285.1	2	4dx5_MIY_B_1103 PDB CREDO	0.515	0.295	0.515	0.009
Rv3285.1	12	1err_RAL_A_600 PDB CREDO	0.615	0.162	0.515	0.009
Rv3285.1	49	3mne_DEX_A_784 PDB CREDO	0.620	0.156	0.514	0.009
Rv3285.1	49	2aax_PDN_A_502 PDB CREDO	0.640	0.135	0.514	0.009
Rv3285.1	2	3g0f_B49_B_9001 PDB CREDO	0.538	0.261	0.514	0.009
Rv3285.1	49	3cs9_NIL_A_600 PDB CREDO	0.593	0.188	0.514	0.009
Rv3285.1	49	2qak_1UN_A_1001 PDB CREDO	0.730	0.059	0.514	0.009
Rv3285.1	12	1err_RAL_B_600 PDB CREDO	0.613	0.164	0.513	0.009
Rv3285.1	2	1lik_ADN_A_699 PDB CREDO	0.565	0.224	0.513	0.009
Rv3285.1	2	3mdv_CL6_A_506 PDB CREDO	0.537	0.262	0.513	0.009
Rv3285.1	12	1hsh_MK1_A_401 PDB CREDO	0.572	0.214	0.512	0.009
Rv3285.1	49	2aa6_STR_B_402 PDB CREDO	0.638	0.137	0.512	0.009
Rv3285.1	49	3gn8_DEX_B_247 PDB CREDO	0.617	0.159	0.512	0.009
Rv3285.1	49	2aa6_STR_A_401 PDB CREDO	0.637	0.137	0.512	0.009
Rv3285.1	49	2hw2_RFP_A_1200 PDB CREDO	0.578	0.206	0.512	0.009
Rv3285.1	49	2q64_1UN_B_1001 PDB CREDO	0.728	0.061	0.512	0.009
Rv3285.1	49	1m2z_DEX_D_401 PDB CREDO	0.616	0.160	0.511	0.009
Rv3285.1	49	2aax_PDN_B_503 PDB CREDO	0.637	0.138	0.511	0.009
Rv3285.1	49	3oez_STI_B_601 PDB CREDO	0.577	0.207	0.511	0.009
Rv3285.1	2	3g0f_B49_A_9001 PDB CREDO	0.535	0.266	0.511	0.009
Rv3285.1	12	1hsh_MK1_C_402 PDB CREDO	0.570	0.217	0.510	0.009
Rv3285.1	12	1z2b_VLB_C_800 PDB CREDO	0.573	0.212	0.510	0.009
Rv3285.1	49	3gn8_DEX_A_247 PDB CREDO	0.614	0.162	0.510	0.009
Rv3285.1	12	3b0w_DGX_A_1 PDB CREDO	0.556	0.235	0.510	0.009
Rv3285.1	12	3frq_ERY_A_195 PDB CREDO	0.540	0.258	0.510	0.009
Rv3285.1	49	3b0w_DGX_B_1 PDB CREDO	0.572	0.214	0.510	0.009
Rv3285.1	19	3ug2_IRE_A_1 PDB CREDO	0.510	0.303	0.510	0.009
Rv3285.1	49	3bbt_FMM_B_91 PDB CREDO	0.843	0.012	0.510	0.009
Rv3285.1	2	1lii_ADN_A_699 PDB CREDO	0.561	0.229	0.509	0.009
Rv3285.1	2	1bx4_ADN_A_350 PDB CREDO	0.584	0.199	0.509	0.009
Rv3285.1	49	3jwq_VIA_D_901 PDB CREDO	0.677	0.099	0.509	0.010
Rv3285.1	12	3bbt_FMM_D_91 PDB CREDO	0.739	0.054	0.509	0.010
Rv3285.1	49	1m2z_DEX_A_301 PDB CREDO	0.612	0.164	0.508	0.010
Rv3285.1	49	2pyn_1UN_A_1001 PDB CREDO	0.723	0.064	0.508	0.010
Rv3285.1	12	2fum_MIX_D_3539 PDB CREDO	0.738	0.055	0.508	0.010
Rv3285.1	49	1s9p_DES_A_459 PDB CREDO	0.725	0.063	0.508	0.010
Rv3285.1	49	2pym_1UN_A_1001 PDB CREDO	0.722	0.065	0.508	0.010
Rv3285.1	49	2q63_1UN_A_1001 PDB CREDO	0.720	0.066	0.506	0.010
Rv3285.1	49	1p93_DEX_C_3999 PDB CREDO	0.610	0.168	0.506	0.010
Rv3285.1	12	1uob_PNN_A_1311 PDB CREDO	0.568	0.220	0.505	0.010
Rv3285.1	12	3oht_1N1_B_1000 PDB CREDO	0.786	0.030	0.505	0.010
Rv3285.1	49	3rgf_BAX_A_465 PDB CREDO	0.551	0.243	0.505	0.010
Rv3285.1	49	3cs9_NIL_B_600 PDB CREDO	0.599	0.180	0.505	0.010
Rv3285.1	2	3ay0_ADN_B_402 PDB CREDO	0.556	0.236	0.505	0.010
Rv3285.1	2	3tbg_RTZ_B_1 PDB CREDO	0.505	0.311	0.505	0.010
Rv3285.1	12	3ut5_LOC_B_502 PDB CREDO	0.585	0.198	0.505	0.010
Rv3285.1	49	3el9_DR7_A_100 PDB CREDO	0.615	0.162	0.505	0.010
Rv3285.1	12	3d91_REM_B_350 PDB CREDO	0.550	0.244	0.504	0.010
Rv3285.1	6	3hy7_097_B_801 PDB CREDO	0.531	0.272	0.503	0.010
Rv3285.1	2	2bxf_DZP_B_2001 PDB CREDO	0.527	0.277	0.503	0.010
Rv3285.1	49	1iep_STI_A_201 PDB CREDO	0.533	0.268	0.503	0.010
Rv3285.1	6	3hy7_097_A_801 PDB CREDO	0.529	0.274	0.502	0.011
Rv3285.1	49	2hyy_STI_A_600 PDB CREDO	0.532	0.270	0.502	0.011
Rv3285.1	2	3ay0_ADN_A_401 PDB CREDO	0.552	0.241	0.502	0.011
Rv3285.1	49	3pyy_STI_A_3 PDB CREDO	0.532	0.270	0.501	0.011
Rv3285.1	49	1c6z_ROC_B_505 PDB CREDO	0.713	0.071	0.501	0.011
Rv3285.1	49	3pyy_STI_B_4 PDB CREDO	0.531	0.272	0.501	0.011
Rv3285.1	12	1hwl_FBI_B_1 PDB CREDO	0.563	0.227	0.501	0.011
Rv3285.1	19	2y7j_B49_B_1294 PDB CREDO	0.748	0.049	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
acetyl-CoAPubChem	0.985	809.571
propionyl-CoAPubChem	0.98	823.597
methylmalonyl-CoAPubChem	0.965	867.607
malonyl-CoAPubChem	0.961	853.58
bicarbonatePubChem	0.957	62.0248
adenosine diphosphatePubChem	0.941	427.201
phosphatePubChem	0.929	96.9872
carbon dioxidePubChem	0.929	44.0095
adenosine triphosphatePubChem	0.927	507.181
acetyl coenzyme-APubChem	0.914	809.571
coenzyme APubChem	0.909	767.534
(2S)-methylmalonyl-CoAPubChem	0.908	867.607
methylmalonyl-coenzyme APubChem	0.905	867.607
methyl-malonyl-CoAPubChem	0.903	867.607
L-methylmalonyl-CoAPubChem	0.902	867.607
methyl-malonyl-coenzyme APubChem	0.902	862.567
H(+)PubChem	0.9	2.01588
CHEBI:15466PubChem	0.9	867.607
dihydronicotinamide formycin dinucleotidePubChem	0.9	665.441
alpha-ketobutyratePubChem	0.9	102.089
Co-APubChem	0.9	767.534
reduced nicotinamide adenine dinucleotidePubChem	0.9	665.441
protiumPubChem	0.9	2.01576
malonylcoenzyme APubChem	0.9	853.58
deuteriumPubChem	0.9	2.01588
n-propionyl-CoAPubChem	0.9	823.597
NAD+PubChem	0.9	663.425