SInCRe - Rv3075c

Tuberculist information

Gene name	Rv3075c
Protein function	Conserved protein
Functional category(tuberculist)	conserved hypotheticals
Gene location(kb)	3438.05
Molecular mass(da)	33100.2
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 307

	  		  	1    MTSMYEQVDTNTADPVAGSRIDPVLARSWLLVNGAHGDRFESAAHSRADIVVLDIEDAVA   60
			  	61   PKDKHAARDNAVRWFGDGNADWVRINGFGTPWWADDLAMLADSPVGGVMLAMVESVDHVT  120
			  	121  ETAKRLPNVPIVALVETARGLERINEIAAAKGTFRLAFGIGDFRRDTGFGEDPATLAYAR  180
			  	181  SRFTIAARAAGLPSAIDGPTIGSNALKLIEATAVSAEFGMTGKICLSPDQCPVVNEGLSP  240
			  	241  SQDEIVWAKEFFAEFARDGGEIRNGSDLPRIARATKILDLARAYGIEVSDFEDEPVHMPA  300
			  	301  PTDTYHY

Known structures in the PDB

No Known structures

Number of amino acids : 307

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
HpcH_HpaI	PF03328	27-228

Mtb Structural Proteome models

Model Number	1
Model name	Rv3075c
Template	1U5H APDB CREDO
Template coverage	10_222
Template Identity(%)	34.6
Model coverage(%)	68.4
Normalized DOPE score	-0.577

Model Number	2
Model name	Rv3075c.1
Template	2BG5 APDB CREDO
Template coverage	257_570
Template Identity(%)	13.4
Model coverage(%)	84.7
Normalized DOPE score	-0.323

Structure Models from Chopin

Model Number	1
Profile	c.1.12.5 - 3.20.20.60 Click for model details
zscore	18.41
Residue begin	1
Residue end	265

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3075c	Gene name	Confidence Score
Rv1240	mdh	0.924
Rv1240	mdh	0.924
Rv2967c	pca	0.916
Rv2967c	pca	0.916
Rv2967c	pca	0.916
Rv2967c	pca	0.916
Rv2967c	pca	0.916
Rv2967c	pca	0.916
Rv1475c	acn	0.907
Rv1475c	acn	0.907

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3075c.1	4	2cbr_A80_A_201 PDB CREDO	0.626	0.149	0.626	0.001
Rv3075c.1	5	1s9p_DES_B_459 PDB CREDO	0.604	0.174	0.604	0.002
Rv3075c.1	5	1s9p_DES_C_500 PDB CREDO	0.595	0.186	0.595	0.002
Rv3075c.1	7	1xkk_FMM_A_91 PDB CREDO	0.594	0.186	0.594	0.002
Rv3075c.1	7	1t46_STI_A_3 PDB CREDO	0.622	0.154	0.590	0.003
Rv3075c.1	5	3ols_EST_A_600 PDB CREDO	0.610	0.167	0.586	0.003
Rv3075c.1	5	2zva_1N1_A_513 PDB CREDO	0.584	0.198	0.584	0.003
Rv3075c.1	5	3ols_EST_B_600 PDB CREDO	0.607	0.170	0.584	0.003
Rv3075c.1	5	3uud_EST_A_600 PDB CREDO	0.605	0.173	0.581	0.003
Rv3075c.1	4	3k54_1N1_A_1 PDB CREDO	0.603	0.175	0.581	0.003
Rv3075c.1	7	3gp0_NIL_A_1 PDB CREDO	0.594	0.186	0.579	0.003
Rv3075c.1	5	2yja_EST_B_1550 PDB CREDO	0.602	0.176	0.579	0.003
Rv3075c.1	5	3uud_EST_B_600 PDB CREDO	0.602	0.176	0.579	0.003
Rv3075c.1	5	1g50_EST_A_600 PDB CREDO	0.602	0.177	0.578	0.003
Rv3075c.1	4	3kw2_ADN_A_300 PDB CREDO	0.578	0.206	0.578	0.003
Rv3075c.1	4	3oht_1N1_A_1000 PDB CREDO	0.574	0.212	0.574	0.003
Rv3075c.1	7	2xkw_P1B_A_1478 PDB CREDO	0.578	0.207	0.563	0.004
Rv3075c.1	4	1s9p_DES_C_500 PDB CREDO	0.631	0.143	0.563	0.004
Rv3075c.1	4	2gqg_1N1_A_501 PDB CREDO	0.605	0.173	0.562	0.004
Rv3075c.1	4	3qlg_1N1_B_601 PDB CREDO	0.606	0.171	0.562	0.004
Rv3075c.1	5	3lfa_1N1_A_361 PDB CREDO	0.635	0.140	0.562	0.004
Rv3075c.1	4	3qlg_1N1_A_601 PDB CREDO	0.605	0.173	0.560	0.004
Rv3075c.1	4	1s9p_DES_B_459 PDB CREDO	0.628	0.147	0.560	0.004
Rv3075c.1	4	3g5d_1N1_B_1 PDB CREDO	0.603	0.175	0.559	0.004
Rv3075c.1	5	3g5d_1N1_B_1 PDB CREDO	0.580	0.204	0.557	0.004
Rv3075c.1	4	3erd_DES_A_600 PDB CREDO	0.599	0.180	0.556	0.004
Rv3075c.1	6	2x1l_ADN_A_601 PDB CREDO	0.556	0.236	0.556	0.005
Rv3075c.1	5	3qlg_1N1_A_601 PDB CREDO	0.578	0.206	0.556	0.005
Rv3075c.1	12	3el9_DR7_A_100 PDB CREDO	0.571	0.216	0.556	0.005
Rv3075c.1	5	3g5d_1N1_A_1 PDB CREDO	0.577	0.207	0.555	0.005
Rv3075c.1	4	2zva_1N1_A_513 PDB CREDO	0.623	0.153	0.555	0.005
Rv3075c.1	4	1kij_NOV_B_444 PDB CREDO	0.575	0.210	0.554	0.005
Rv3075c.1	7	1uwj_BAX_A_1723 PDB CREDO	0.669	0.107	0.553	0.005
Rv3075c.1	5	3qlg_1N1_B_601 PDB CREDO	0.575	0.210	0.553	0.005
Rv3075c.1	4	3g5d_1N1_A_1 PDB CREDO	0.597	0.183	0.553	0.005
Rv3075c.1	4	3kw2_ADN_B_300 PDB CREDO	0.618	0.158	0.551	0.005
Rv3075c.1	4	2fum_MIX_A_539 PDB CREDO	0.593	0.188	0.551	0.005
Rv3075c.1	12	3pww_ROC_A_1001 PDB CREDO	0.578	0.206	0.548	0.005
Rv3075c.1	4	3oct_1N1_A_663 PDB CREDO	0.632	0.143	0.547	0.005
Rv3075c.1	4	1s9p_DES_A_459 PDB CREDO	0.606	0.172	0.543	0.006
Rv3075c.1	7	3cs9_NIL_C_600 PDB CREDO	0.572	0.214	0.543	0.006
Rv3075c.1	4	1s9p_DES_D_600 PDB CREDO	0.605	0.173	0.543	0.006
Rv3075c.1	4	3bbt_FMM_B_91 PDB CREDO	0.563	0.226	0.542	0.006
Rv3075c.1	5	2uxo_TAC_B_1211 PDB CREDO	0.564	0.225	0.542	0.006
Rv3075c.1	7	3cs9_NIL_D_600 PDB CREDO	0.571	0.216	0.541	0.006
Rv3075c.1	5	1a52_EST_B_2 PDB CREDO	0.637	0.137	0.540	0.006
Rv3075c.1	4	1gs4_ZK5_A_1918 PDB CREDO	0.579	0.205	0.538	0.006
Rv3075c.1	4	2fum_MIX_D_3539 PDB CREDO	0.644	0.131	0.538	0.006
Rv3075c.1	6	2y7j_B49_C_1294 PDB CREDO	0.595	0.185	0.538	0.006
Rv3075c.1	4	1mx1_THA_E_5 PDB CREDO	0.556	0.235	0.536	0.006
Rv3075c.1	12	3q70_RIT_A_2001 PDB CREDO	0.654	0.121	0.535	0.006
Rv3075c.1	12	3tne_RIT_B_401 PDB CREDO	0.716	0.069	0.535	0.006
Rv3075c.1	5	3oht_1N1_A_1000 PDB CREDO	0.600	0.179	0.535	0.006
Rv3075c.1	5	1a52_EST_A_1 PDB CREDO	0.630	0.145	0.534	0.006
Rv3075c.1	5	1g50_EST_C_2600 PDB CREDO	0.630	0.145	0.534	0.006
Rv3075c.1	5	2j7x_EST_A_1454 PDB CREDO	0.630	0.145	0.534	0.006
Rv3075c.1	5	3hm1_J3Z_B_1 PDB CREDO	0.630	0.145	0.534	0.006
Rv3075c.1	4	3o1c_ADN_A_127 PDB CREDO	0.554	0.238	0.534	0.006
Rv3075c.1	5	1ere_EST_C_600 PDB CREDO	0.629	0.146	0.533	0.007
Rv3075c.1	4	3oht_1N1_B_1000 PDB CREDO	0.595	0.185	0.533	0.007
Rv3075c.1	4	4eb6_VLB_C_503 PDB CREDO	0.574	0.212	0.533	0.007
Rv3075c.1	5	1ere_EST_D_600 PDB CREDO	0.628	0.147	0.533	0.007
Rv3075c.1	5	1ere_EST_F_600 PDB CREDO	0.628	0.147	0.533	0.007
Rv3075c.1	5	2ocf_EST_A_596 PDB CREDO	0.628	0.147	0.533	0.007
Rv3075c.1	5	1pcg_EST_A_1 PDB CREDO	0.627	0.148	0.532	0.007
Rv3075c.1	4	1mx1_THA_D_4 PDB CREDO	0.595	0.185	0.530	0.007
Rv3075c.1	4	2uxo_TAC_B_1211 PDB CREDO	0.619	0.157	0.530	0.007
Rv3075c.1	5	2y7j_B49_B_1294 PDB CREDO	0.551	0.243	0.529	0.007
Rv3075c.1	5	3oll_EST_B_600 PDB CREDO	0.624	0.151	0.529	0.007
Rv3075c.1	4	3qgz_ADN_A_127 PDB CREDO	0.549	0.245	0.529	0.007
Rv3075c.1	5	1qkt_EST_A_600 PDB CREDO	0.623	0.152	0.529	0.007
Rv3075c.1	4	2xkw_P1B_B_1475 PDB CREDO	0.569	0.218	0.529	0.007
Rv3075c.1	4	3erd_DES_B_800 PDB CREDO	0.569	0.218	0.529	0.007
Rv3075c.1	12	2fxd_DR7_A_102 PDB CREDO	0.543	0.254	0.528	0.007
Rv3075c.1	5	3oll_EST_A_600 PDB CREDO	0.623	0.153	0.528	0.007
Rv3075c.1	5	2j7y_E3O_A_1454 PDB CREDO	0.569	0.218	0.527	0.007
Rv3075c.1	7	1opj_STI_A_3 PDB CREDO	0.602	0.177	0.527	0.007
Rv3075c.1	12	1c6y_MK1_B_524 PDB CREDO	0.541	0.257	0.526	0.007
Rv3075c.1	4	2prg_BRL_A_1 PDB CREDO	0.586	0.196	0.526	0.007
Rv3075c.1	4	2fum_MIX_B_1539 PDB CREDO	0.613	0.164	0.525	0.007
Rv3075c.1	4	3ols_EST_A_600 PDB CREDO	0.613	0.164	0.525	0.007
Rv3075c.1	4	3ols_EST_B_600 PDB CREDO	0.613	0.164	0.525	0.007
Rv3075c.1	4	3sxr_1N1_A_1 PDB CREDO	0.589	0.192	0.525	0.007
Rv3075c.1	4	1mx1_THA_F_6 PDB CREDO	0.588	0.193	0.524	0.008
Rv3075c.1	7	3bjw_SVR_E_503 PDB CREDO	0.566	0.222	0.523	0.008
Rv3075c.1	4	1g50_EST_A_600 PDB CREDO	0.611	0.166	0.523	0.008
Rv3075c.1	4	4eyb_0WO_B_301 PDB CREDO	0.542	0.255	0.523	0.008
Rv3075c.1	12	1c6z_ROC_B_505 PDB CREDO	0.626	0.149	0.522	0.008
Rv3075c.1	4	1fm6_BRL_D_503 PDB CREDO	0.582	0.201	0.522	0.008
Rv3075c.1	7	1uwj_BAX_B_1723 PDB CREDO	0.687	0.091	0.521	0.008
Rv3075c.1	7	1opj_STI_B_4 PDB CREDO	0.595	0.185	0.521	0.008
Rv3075c.1	7	3bjw_SVR_B_501 PDB CREDO	0.521	0.286	0.521	0.008
Rv3075c.1	7	3bjw_SVR_H_504 PDB CREDO	0.521	0.286	0.521	0.008
Rv3075c.1	5	2fum_MIX_B_1539 PDB CREDO	0.542	0.255	0.521	0.008
Rv3075c.1	5	3kw2_ADN_B_300 PDB CREDO	0.521	0.286	0.521	0.008
Rv3075c.1	4	3adx_IMN_B_3 PDB CREDO	0.607	0.171	0.519	0.008
Rv3075c.1	5	1lw0_NVP_A_999 PDB CREDO	0.519	0.289	0.519	0.008
Rv3075c.1	5	3ti1_B49_A_299 PDB CREDO	0.540	0.259	0.519	0.008
Rv3075c.1	4	2yja_EST_B_1550 PDB CREDO	0.606	0.172	0.519	0.008
Rv3075c.1	4	3k2h_LYA_A_514 PDB CREDO	0.560	0.231	0.519	0.008
Rv3075c.1	4	3uud_EST_B_600 PDB CREDO	0.606	0.172	0.519	0.008
Rv3075c.1	12	3ekq_ROC_A_100 PDB CREDO	0.518	0.290	0.518	0.008
Rv3075c.1	5	3oht_1N1_B_1000 PDB CREDO	0.649	0.126	0.518	0.008
Rv3075c.1	4	3uud_EST_A_600 PDB CREDO	0.605	0.173	0.518	0.008
Rv3075c.1	7	3k5v_STI_A_2 PDB CREDO	0.608	0.170	0.517	0.008
Rv3075c.1	4	1kij_NOV_A_400 PDB CREDO	0.618	0.158	0.517	0.008
Rv3075c.1	12	1t46_STI_A_3 PDB CREDO	0.545	0.251	0.516	0.008
Rv3075c.1	4	2j7y_E3O_A_1454 PDB CREDO	0.536	0.264	0.516	0.008
Rv3075c.1	7	4asd_BAX_A_1500 PDB CREDO	0.680	0.097	0.516	0.009
Rv3075c.1	4	1jzs_MRC_A_1301 PDB CREDO	0.536	0.265	0.516	0.009
Rv3075c.1	5	1s9p_DES_A_459 PDB CREDO	0.645	0.130	0.515	0.009
Rv3075c.1	5	3cs8_BRL_A_503 PDB CREDO	0.515	0.296	0.515	0.009
Rv3075c.1	6	1hk4_T44_A_1008 PDB CREDO	0.541	0.256	0.514	0.009
Rv3075c.1	7	3bjw_SVR_F_502 PDB CREDO	0.513	0.297	0.513	0.009
Rv3075c.1	5	1s9p_DES_D_600 PDB CREDO	0.642	0.132	0.513	0.009
Rv3075c.1	5	1mx1_THA_D_4 PDB CREDO	0.513	0.298	0.513	0.009
Rv3075c.1	5	3r9c_ECL_A_452 PDB CREDO	0.580	0.204	0.513	0.009
Rv3075c.1	4	3fuu_ADN_A_0 PDB CREDO	0.554	0.239	0.513	0.009
Rv3075c.1	7	3b0w_DGX_B_1 PDB CREDO	0.603	0.176	0.513	0.009
Rv3075c.1	5	3erd_DES_B_800 PDB CREDO	0.619	0.157	0.512	0.009
Rv3075c.1	5	1g50_EST_B_1600 PDB CREDO	0.690	0.088	0.512	0.009
Rv3075c.1	7	2qxs_RAL_B_600 PDB CREDO	0.569	0.218	0.512	0.009
Rv3075c.1	5	3erd_DES_A_600 PDB CREDO	0.618	0.158	0.512	0.009
Rv3075c.1	7	3oez_STI_A_601 PDB CREDO	0.636	0.139	0.511	0.009
Rv3075c.1	5	1ere_EST_B_600 PDB CREDO	0.689	0.089	0.511	0.009
Rv3075c.1	5	1qku_EST_B_600 PDB CREDO	0.689	0.089	0.511	0.009
Rv3075c.1	12	3tne_RIT_A_401 PDB CREDO	0.685	0.093	0.511	0.009
Rv3075c.1	4	1mx1_THA_C_3 PDB CREDO	0.570	0.217	0.511	0.009
Rv3075c.1	7	3cs9_NIL_B_600 PDB CREDO	0.568	0.220	0.510	0.009
Rv3075c.1	7	3gcs_BAX_A_401 PDB CREDO	0.673	0.103	0.510	0.009
Rv3075c.1	7	3sm2_478_A_126 PDB CREDO	0.536	0.263	0.510	0.009
Rv3075c.1	5	1ere_EST_A_600 PDB CREDO	0.687	0.091	0.510	0.009
Rv3075c.1	5	1ere_EST_E_600 PDB CREDO	0.687	0.091	0.510	0.009
Rv3075c.1	5	1qku_EST_A_600 PDB CREDO	0.687	0.091	0.510	0.009
Rv3075c.1	5	1qku_EST_C_600 PDB CREDO	0.687	0.091	0.510	0.009
Rv3075c.1	5	1mx1_THA_F_6 PDB CREDO	0.509	0.304	0.509	0.009
Rv3075c.1	5	1pcg_EST_B_2 PDB CREDO	0.685	0.093	0.508	0.010
Rv3075c.1	4	1mx1_THA_A_1 PDB CREDO	0.645	0.130	0.508	0.010
Rv3075c.1	7	2qxs_RAL_A_600 PDB CREDO	0.565	0.224	0.508	0.010
Rv3075c.1	7	3cs9_NIL_A_600 PDB CREDO	0.580	0.203	0.508	0.010
Rv3075c.1	7	3gvu_STI_A_1001 PDB CREDO	0.631	0.143	0.508	0.010
Rv3075c.1	7	3pyy_STI_A_3 PDB CREDO	0.631	0.143	0.508	0.010
Rv3075c.1	6	1hk5_T44_A_1008 PDB CREDO	0.534	0.266	0.508	0.010
Rv3075c.1	7	2hyy_STI_C_600 PDB CREDO	0.631	0.144	0.507	0.010
Rv3075c.1	4	3jwq_VIA_B_901 PDB CREDO	0.546	0.250	0.507	0.010
Rv3075c.1	7	2hyy_STI_A_600 PDB CREDO	0.630	0.145	0.507	0.010
Rv3075c.1	7	3pyy_STI_B_4 PDB CREDO	0.630	0.145	0.506	0.010
Rv3075c.1	7	3mss_STI_B_1 PDB CREDO	0.629	0.146	0.506	0.010
Rv3075c.1	4	1qkn_RAL_A_600 PDB CREDO	0.669	0.107	0.506	0.010
Rv3075c.1	7	3mss_STI_D_1 PDB CREDO	0.629	0.146	0.506	0.010
Rv3075c.1	7	3ms9_STI_B_1 PDB CREDO	0.629	0.146	0.505	0.010
Rv3075c.1	7	3mss_STI_A_1 PDB CREDO	0.628	0.147	0.505	0.010
Rv3075c.1	5	3hm1_J3Z_A_2 PDB CREDO	0.681	0.096	0.505	0.010
Rv3075c.1	5	3sxr_1N1_A_1 PDB CREDO	0.505	0.310	0.505	0.010
Rv3075c.1	4	4eyb_0WO_A_303 PDB CREDO	0.563	0.226	0.505	0.010
Rv3075c.1	4	3qt0_486_A_4 PDB CREDO	0.604	0.174	0.505	0.010
Rv3075c.1	7	2hyy_STI_D_600 PDB CREDO	0.628	0.147	0.505	0.010
Rv3075c.1	7	3k5v_STI_B_2 PDB CREDO	0.628	0.147	0.505	0.010
Rv3075c.1	12	3prs_RIT_A_1001 PDB CREDO	0.621	0.155	0.505	0.010
Rv3075c.1	5	2uxp_CLM_B_1211 PDB CREDO	0.680	0.097	0.504	0.010
Rv3075c.1	7	3ms9_STI_A_1 PDB CREDO	0.626	0.149	0.503	0.010
Rv3075c.1	7	1iep_STI_B_202 PDB CREDO	0.626	0.150	0.503	0.010
Rv3075c.1	4	3sxr_1N1_B_2 PDB CREDO	0.588	0.194	0.503	0.010
Rv3075c.1	7	1iep_STI_A_201 PDB CREDO	0.625	0.150	0.503	0.010
Rv3075c.1	5	3bbt_FMM_B_91 PDB CREDO	0.543	0.254	0.502	0.011
Rv3075c.1	7	3mss_STI_C_1 PDB CREDO	0.624	0.151	0.502	0.011
Rv3075c.1	5	1gwr_EST_A_600 PDB CREDO	0.677	0.100	0.502	0.011
Rv3075c.1	5	1gwr_EST_B_600 PDB CREDO	0.677	0.100	0.502	0.011
Rv3075c.1	5	2uxp_CLM_A_1211 PDB CREDO	0.677	0.100	0.502	0.011
Rv3075c.1	5	2xkw_P1B_B_1475 PDB CREDO	0.606	0.172	0.502	0.011
Rv3075c.1	7	3el9_DR7_A_100 PDB CREDO	0.543	0.254	0.502	0.011
Rv3075c.1	4	2w8y_NDR_B_1000 PDB CREDO	0.563	0.226	0.502	0.011
Rv3075c.1	4	2prg_BRL_B_2 PDB CREDO	0.559	0.231	0.501	0.011
Rv3075c.1	6	2x1l_ADN_B_601 PDB CREDO	0.589	0.193	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
oxaloacetatePubChem	0.912	132.072
citratePubChem	0.908	192.124