SInCRe - Rv2922c

Tuberculist information

Gene name	smc
Protein function	Probable chromosome partition protein Smc
Functional category(tuberculist)	cell wall and cell processes
Gene location(kb)	3234.19
Molecular mass(da)	130605
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 1205

	  		  	1    VYLKSLTLKGFKSFAAPTTLRFEPGITAVVGPNGSGKSNVVDALAWVMGEQGAKTLRGGK   60
			  	61   MEDVIFAGTSSRAPLGRAEVTVSIDNSDNALPIEYTEVSITRRMFRDGASEYEINGSSCR  120
			  	121  LMDVQELLSDSGIGREMHVIVGQGKLEEILQSRPEDRRAFIEEAAGVLKHRKRKEKALRK  180
			  	181  LDTMAANLARLTDLTTELRRQLKPLGRQAEAAQRAAAIQADLRDARLRLAADDLVSRRAE  240
			  	241  REAVFQAEAAMRREHDEAAARLAVASEELAAHESAVAELSTRAESIQHTWFGLSALAERV  300
			  	301  DATVRIASERAHHLDIEPVAVSDTDPRKPEELEAEAQQVAVAEQQLLAELDAARARLDAA  360
			  	361  RAELADRERRAAEADRAHLAAVREEADRREGLARLAGQVETMRARVESIDESVARLSERI  420
			  	421  EDAAMRAQQTRAEFETVQGRIGELDQGEVGLDEHHERTVAALRLADERVAELQSAERAAE  480
			  	481  RQVASLRARIDALAVGLQRKDGAAWLAHNRSGAGLFGSIAQLVKVRSGYEAALAAALGPA  540
			  	541  ADALAVDGLTAAGSAVSALKQADGGRAVLVLSDWPAPQAPQSASGEMLPSGAQWALDLVE  600
			  	601  SPPQLVGAMIAMLSGVAVVNDLTEAMGLVEIRPELRAVTVDGDLVGAGWVSGGSDRKLST  660
			  	661  LEVTSEIDKARSELAAAEALAAQLNAALAGALTEQSARQDAAEQALAALNESDTAISAMY  720
			  	721  EQLGRLGQEARAAEEEWNRLLQQRTEQEAVRTQTLDDVIQLETQLRKAQETQRVQVAQPI  780
			  	781  DRQAISAAADRARGVEVEARLAVRTAEERANAVRGRADSLRRAAAAEREARVRAQQARAA  840
			  	841  RLHAAAVAAAVADCGRLLAGRLHRAVDGASQLRDASAAQRQQRLAAMAAVRDEVNTLSAR  900
			  	901  VGELTDSLHRDELANAQAALRIEQLEQMVLEQFGMAPADLITEYGPHVALPPTELEMAEF  960
			  	961  EQARERGEQVIAPAPMPFDRVTQERRAKRAERALAELGRVNPLALEEFAALEERYNFLST 1020
			  	1021 QLEDVKAARKDLLGVVADVDARILQVFNDAFVDVEREFRGVFTALFPGGEGRLRLTEPDD 1080
			  	1081 MLTTGIEVEARPPGKKITRLSLLSGGEKALTAVAMLVAIFRARPSPFYIMDEVEAALDDV 1140
			  	1141 NLRRLLSLFEQLREQSQIIIITHQKPTMEVADALYGVTMQNDGITAVISQRMRGQQVDQL 1200
			  	1201 VTNSS

Known structures in the PDB

No Known structures

Number of amino acids : 1205

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
SMC_N	PF02463	2-1186
SMC_hinge	PF06470	512-629

Mtb Structural Proteome models

Model Number	1
Model name	Rv2922c
Template	1E69 APDB CREDO
Template coverage	140_1164
Template Identity(%)	45.5
Model coverage(%)	12.2
Normalized DOPE score	0.016

Model Number	2
Model name	Rv2922c.2
Template	1GXJ APDB CREDO
Template coverage	498_658
Template Identity(%)	26.2
Model coverage(%)	13.2
Normalized DOPE score	0.039

Model Number	3
Model name	Rv2922c.1
Template	1E69 APDB CREDO
Template coverage	1_1075
Template Identity(%)	35.1
Model coverage(%)	15.8
Normalized DOPE score	0.805

Structure Models from Chopin

Model Number	1
Profile	d.215.1.1 Click for model details
zscore	26.66
Residue begin	498
Residue end	655

Model Number	2
Profile	c.37.1.12 - 3.40.50.300 Click for model details
zscore	17.64
Residue begin	1
Residue end	412

Model Number	3
Profile	a.238.1.4 Click for model details
zscore	9.22
Residue begin	238
Residue end	517

Model Number	4
Profile	c.37.1.12, d.58.18.13 - 3.30.70.260, 3.40.50.300 Click for model details
zscore	5.06
Residue begin	5
Residue end	353

Model Number	5
Profile	3.30.1880.10 Click for model details
zscore	4.2
Residue begin	1059
Residue end	1134

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2922c	Gene name	Confidence Score
Rv2921c	ftsY	0.964
Rv2921c	ftsY	0.964
Rv1710	scpB	0.961
Rv1709	scpA	0.937

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2922c.2	2	1sa1_POD_B_700 PDB CREDO	0.698	0.082	0.658	0.001
Rv2922c.2	2	3spk_TPV_B_100 PDB CREDO	0.670	0.106	0.651	0.001
Rv2922c.2	2	1sa1_POD_D_701 PDB CREDO	0.705	0.077	0.645	0.001
Rv2922c.2	2	1n49_RIT_D_401 PDB CREDO	0.639	0.136	0.639	0.001
Rv2922c.1	1	1mx1_THA_A_1 PDB CREDO	0.658	0.117	0.630	0.001
Rv2922c.2	2	1uwj_BAX_A_1723 PDB CREDO	0.648	0.126	0.630	0.001
Rv2922c.1	1	1mx1_THA_B_2 PDB CREDO	0.680	0.097	0.625	0.001
Rv2922c.1	1	1mx1_THA_D_4 PDB CREDO	0.735	0.057	0.623	0.001
Rv2922c.2	2	1xkk_FMM_A_91 PDB CREDO	0.762	0.041	0.613	0.002
Rv2922c.2	2	1t46_STI_A_3 PDB CREDO	0.721	0.066	0.611	0.002
Rv2922c.1	1	1mx1_THA_F_6 PDB CREDO	0.714	0.070	0.605	0.002
Rv2922c.1	1	3ads_IMN_B_3 PDB CREDO	0.605	0.173	0.605	0.002
Rv2922c.2	2	4asd_BAX_A_1500 PDB CREDO	0.640	0.135	0.603	0.002
Rv2922c.2	2	3e22_LOC_B_700 PDB CREDO	0.722	0.065	0.603	0.002
Rv2922c.2	2	1uwj_BAX_B_1723 PDB CREDO	0.639	0.136	0.602	0.002
Rv2922c.2	2	3e22_LOC_D_700 PDB CREDO	0.722	0.065	0.602	0.002
Rv2922c.2	2	3h52_486_B_1 PDB CREDO	0.657	0.117	0.602	0.002
Rv2922c.1	1	2fum_MIX_B_1539 PDB CREDO	0.680	0.097	0.600	0.002
Rv2922c.2	2	1uwh_BAX_A_1723 PDB CREDO	0.675	0.101	0.600	0.002
Rv2922c.2	2	2qxs_RAL_A_600 PDB CREDO	0.670	0.106	0.599	0.002
Rv2922c.2	2	1uwh_BAX_B_1723 PDB CREDO	0.674	0.102	0.599	0.002
Rv2922c.1	1	2fum_MIX_C_2539 PDB CREDO	0.706	0.076	0.598	0.002
Rv2922c.2	2	3so9_017_A_100 PDB CREDO	0.673	0.103	0.598	0.002
Rv2922c.2	2	2qxs_RAL_B_600 PDB CREDO	0.668	0.108	0.597	0.002
Rv2922c.2	2	2nni_MTK_A_501 PDB CREDO	0.613	0.163	0.596	0.002
Rv2922c.2	2	3h52_486_D_2 PDB CREDO	0.670	0.105	0.595	0.002
Rv2922c.2	2	1n49_RIT_B_301 PDB CREDO	0.647	0.127	0.595	0.002
Rv2922c.2	2	3ut5_LOC_D_502 PDB CREDO	0.705	0.077	0.588	0.003
Rv2922c.1	1	3tmz_06X_A_503 PDB CREDO	0.585	0.198	0.585	0.003
Rv2922c.2	2	3h52_486_A_3 PDB CREDO	0.657	0.117	0.584	0.003
Rv2922c.2	2	3heg_BAX_A_1 PDB CREDO	0.636	0.139	0.582	0.003
Rv2922c.2	2	3oez_STI_A_601 PDB CREDO	0.581	0.203	0.581	0.003
Rv2922c.2	2	3ut5_LOC_B_502 PDB CREDO	0.654	0.121	0.581	0.003
Rv2922c.2	2	3sm2_478_A_126 PDB CREDO	0.759	0.043	0.580	0.003
Rv2922c.2	2	3frq_ERY_A_195 PDB CREDO	0.597	0.183	0.580	0.003
Rv2922c.2	2	3gcs_BAX_A_401 PDB CREDO	0.615	0.162	0.580	0.003
Rv2922c.1	1	3adx_IMN_B_3 PDB CREDO	0.654	0.121	0.577	0.003
Rv2922c.2	2	3ufn_ROC_A_401 PDB CREDO	0.693	0.086	0.572	0.003
Rv2922c.1	1	1xbb_STI_A_1 PDB CREDO	0.750	0.048	0.569	0.004
Rv2922c.2	2	1z2b_VLB_C_800 PDB CREDO	0.619	0.157	0.566	0.004
Rv2922c.2	2	3spk_TPV_A_100 PDB CREDO	0.773	0.036	0.566	0.004
Rv2922c.2	2	3gp0_NIL_A_1 PDB CREDO	0.684	0.093	0.565	0.004
Rv2922c.1	1	1dtl_BEP_A_204 PDB CREDO	0.639	0.135	0.564	0.004
Rv2922c.2	2	3bbt_FMM_D_91 PDB CREDO	0.795	0.027	0.563	0.004
Rv2922c.2	2	2oiq_STI_A_1001 PDB CREDO	0.614	0.163	0.562	0.004
Rv2922c.2	2	3lzv_017_A_200 PDB CREDO	0.594	0.186	0.561	0.004
Rv2922c.2	2	3b0w_DGX_B_1 PDB CREDO	0.593	0.187	0.561	0.004
Rv2922c.1	1	3uud_EST_A_600 PDB CREDO	0.634	0.141	0.559	0.004
Rv2922c.2	2	2jfa_RAL_B_600 PDB CREDO	0.649	0.125	0.559	0.004
Rv2922c.2	2	2oax_SNL_D_4001 PDB CREDO	0.610	0.167	0.559	0.004
Rv2922c.1	1	3ols_EST_A_600 PDB CREDO	0.633	0.142	0.558	0.004
Rv2922c.2	2	1err_RAL_A_600 PDB CREDO	0.648	0.127	0.558	0.004
Rv2922c.1	1	3uud_EST_B_600 PDB CREDO	0.632	0.143	0.558	0.004
Rv2922c.2	2	2pl0_STI_A_200 PDB CREDO	0.609	0.169	0.557	0.004
Rv2922c.2	2	2hyy_STI_A_600 PDB CREDO	0.557	0.234	0.557	0.004
Rv2922c.2	2	3ms9_STI_A_1 PDB CREDO	0.557	0.234	0.557	0.004
Rv2922c.2	2	2y6o_1N1_A_1892 PDB CREDO	0.688	0.090	0.557	0.004
Rv2922c.2	2	2oax_SNL_A_1001 PDB CREDO	0.607	0.170	0.556	0.005
Rv2922c.2	2	2oax_SNL_F_6001 PDB CREDO	0.607	0.171	0.556	0.005
Rv2922c.2	2	1iep_STI_A_201 PDB CREDO	0.555	0.237	0.555	0.005
Rv2922c.2	2	2oax_SNL_E_5001 PDB CREDO	0.607	0.171	0.555	0.005
Rv2922c.2	2	3pyy_STI_B_4 PDB CREDO	0.555	0.237	0.555	0.005
Rv2922c.2	2	3gvu_STI_A_1001 PDB CREDO	0.555	0.237	0.555	0.005
Rv2922c.2	2	3k5v_STI_B_2 PDB CREDO	0.555	0.237	0.555	0.005
Rv2922c.2	2	2hyy_STI_D_600 PDB CREDO	0.554	0.238	0.554	0.005
Rv2922c.2	2	3ms9_STI_B_1 PDB CREDO	0.554	0.238	0.554	0.005
Rv2922c.2	2	3mss_STI_B_1 PDB CREDO	0.554	0.238	0.554	0.005
Rv2922c.1	1	3ols_EST_B_600 PDB CREDO	0.628	0.147	0.554	0.005
Rv2922c.2	2	3mss_STI_A_1 PDB CREDO	0.554	0.238	0.554	0.005
Rv2922c.2	2	3pyy_STI_A_3 PDB CREDO	0.554	0.238	0.554	0.005
Rv2922c.2	2	1err_RAL_B_600 PDB CREDO	0.643	0.132	0.554	0.005
Rv2922c.2	2	2hyy_STI_B_600 PDB CREDO	0.605	0.173	0.554	0.005
Rv2922c.1	1	2yja_EST_B_1550 PDB CREDO	0.627	0.148	0.553	0.005
Rv2922c.2	2	3cs9_NIL_A_600 PDB CREDO	0.602	0.177	0.553	0.005
Rv2922c.1	1	1wrk_TFP_A_202 PDB CREDO	0.632	0.143	0.553	0.005
Rv2922c.1	1	1ya4_CTX_B_2 PDB CREDO	0.652	0.122	0.553	0.005
Rv2922c.2	2	2w8y_486_A_1000 PDB CREDO	0.586	0.196	0.553	0.005
Rv2922c.2	2	3mss_STI_D_1 PDB CREDO	0.553	0.240	0.553	0.005
Rv2922c.2	2	1iep_STI_B_202 PDB CREDO	0.552	0.241	0.552	0.005
Rv2922c.1	1	3hbb_TMQ_C_613 PDB CREDO	0.577	0.208	0.552	0.005
Rv2922c.2	2	3mss_STI_C_1 PDB CREDO	0.552	0.241	0.552	0.005
Rv2922c.1	1	1g50_EST_A_600 PDB CREDO	0.625	0.150	0.552	0.005
Rv2922c.1	1	1mx1_THA_E_5 PDB CREDO	0.758	0.044	0.552	0.005
Rv2922c.1	1	3lfa_1N1_A_361 PDB CREDO	0.575	0.210	0.551	0.005
Rv2922c.1	1	1a52_EST_A_1 PDB CREDO	0.551	0.242	0.551	0.005
Rv2922c.1	1	1a52_EST_B_2 PDB CREDO	0.551	0.242	0.551	0.005
Rv2922c.2	2	2hyy_STI_C_600 PDB CREDO	0.551	0.242	0.551	0.005
Rv2922c.2	2	3d91_REM_B_350 PDB CREDO	0.584	0.199	0.551	0.005
Rv2922c.1	1	1g50_EST_C_2600 PDB CREDO	0.550	0.243	0.550	0.005
Rv2922c.1	1	2j7x_EST_A_1454 PDB CREDO	0.550	0.243	0.550	0.005
Rv2922c.1	1	3clb_TMQ_A_611 PDB CREDO	0.573	0.213	0.549	0.005
Rv2922c.1	1	3oll_EST_A_600 PDB CREDO	0.549	0.246	0.549	0.005
Rv2922c.2	2	3el0_1UN_A_201 PDB CREDO	0.580	0.204	0.548	0.005
Rv2922c.2	2	3d91_REM_A_350 PDB CREDO	0.581	0.203	0.548	0.005
Rv2922c.1	1	1ere_EST_C_600 PDB CREDO	0.548	0.247	0.548	0.005
Rv2922c.1	1	1ere_EST_F_600 PDB CREDO	0.547	0.249	0.547	0.005
Rv2922c.1	1	3oll_EST_B_600 PDB CREDO	0.547	0.249	0.547	0.005
Rv2922c.1	1	3bbt_FMM_B_91 PDB CREDO	0.697	0.083	0.546	0.005
Rv2922c.1	1	2ocf_EST_A_596 PDB CREDO	0.546	0.250	0.546	0.005
Rv2922c.2	2	3b0w_DGX_A_1 PDB CREDO	0.578	0.207	0.545	0.005
Rv2922c.1	1	3hm1_J3Z_B_1 PDB CREDO	0.545	0.251	0.545	0.005
Rv2922c.2	2	1jg2_ADN_A_500 PDB CREDO	0.796	0.026	0.545	0.005
Rv2922c.1	1	1ere_EST_D_600 PDB CREDO	0.544	0.253	0.544	0.006
Rv2922c.2	2	1c6y_MK1_B_524 PDB CREDO	0.625	0.151	0.544	0.006
Rv2922c.1	1	1pcg_EST_A_1 PDB CREDO	0.543	0.254	0.543	0.006
Rv2922c.1	1	1ya4_CTX_C_3 PDB CREDO	0.640	0.134	0.543	0.006
Rv2922c.2	2	1opj_STI_A_3 PDB CREDO	0.590	0.191	0.542	0.006
Rv2922c.1	1	1qkt_EST_A_600 PDB CREDO	0.542	0.255	0.542	0.006
Rv2922c.2	2	2jfa_RAL_A_600 PDB CREDO	0.649	0.125	0.542	0.006
Rv2922c.2	2	1opj_STI_B_4 PDB CREDO	0.590	0.192	0.542	0.006
Rv2922c.1	1	1m17_AQ4_A_999 PDB CREDO	0.589	0.192	0.542	0.006
Rv2922c.2	2	1hwk_117_B_1 PDB CREDO	0.542	0.256	0.542	0.006
Rv2922c.1	1	2fum_MIX_A_539 PDB CREDO	0.772	0.037	0.542	0.006
Rv2922c.2	2	3k5v_STI_A_2 PDB CREDO	0.573	0.213	0.541	0.006
Rv2922c.2	2	3oez_STI_B_601 PDB CREDO	0.646	0.129	0.539	0.006
Rv2922c.2	2	3frq_ERY_B_195 PDB CREDO	0.644	0.130	0.538	0.006
Rv2922c.2	2	3ogp_017_B_200 PDB CREDO	0.538	0.261	0.538	0.006
Rv2922c.1	1	1mx1_THA_C_3 PDB CREDO	0.794	0.027	0.538	0.006
Rv2922c.1	1	2nnj_225_A_501 PDB CREDO	0.709	0.074	0.537	0.006
Rv2922c.2	2	3cs9_NIL_B_600 PDB CREDO	0.601	0.178	0.537	0.006
Rv2922c.1	1	3kw2_ADN_B_300 PDB CREDO	0.633	0.142	0.536	0.006
Rv2922c.2	2	1t7j_478_A_200 PDB CREDO	0.603	0.175	0.536	0.006
Rv2922c.1	1	3clb_TMQ_B_612 PDB CREDO	0.610	0.167	0.534	0.006
Rv2922c.1	1	3clb_TMQ_C_613 PDB CREDO	0.639	0.136	0.534	0.006
Rv2922c.2	2	3el9_DR7_A_100 PDB CREDO	0.613	0.164	0.533	0.007
Rv2922c.1	1	1sn5_T3_C_601 PDB CREDO	0.556	0.236	0.533	0.007
Rv2922c.1	1	1r9o_FLP_A_501 PDB CREDO	0.608	0.170	0.532	0.007
Rv2922c.2	2	3tne_RIT_A_401 PDB CREDO	0.636	0.138	0.531	0.007
Rv2922c.1	1	3hbb_TMQ_A_611 PDB CREDO	0.636	0.139	0.531	0.007
Rv2922c.2	2	2qak_1UN_A_1001 PDB CREDO	0.712	0.072	0.531	0.007
Rv2922c.2	2	2q64_1UN_B_1001 PDB CREDO	0.712	0.072	0.531	0.007
Rv2922c.2	2	1lhv_NOG_A_301 PDB CREDO	0.655	0.120	0.530	0.007
Rv2922c.2	2	3ogp_017_A_200 PDB CREDO	0.578	0.206	0.530	0.007
Rv2922c.2	2	2pym_1UN_A_1001 PDB CREDO	0.710	0.073	0.529	0.007
Rv2922c.2	2	2aoj_FRD_C_305 PDB CREDO	0.544	0.253	0.528	0.007
Rv2922c.2	2	3ekq_ROC_A_100 PDB CREDO	0.590	0.191	0.528	0.007
Rv2922c.2	2	3tkd_CYZ_B_267 PDB CREDO	0.594	0.186	0.528	0.007
Rv2922c.2	2	2pyn_1UN_A_1001 PDB CREDO	0.708	0.075	0.528	0.007
Rv2922c.2	2	2q63_1UN_A_1001 PDB CREDO	0.706	0.076	0.527	0.007
Rv2922c.2	2	2ab2_SNL_A_502 PDB CREDO	0.627	0.148	0.524	0.008
Rv2922c.2	2	3cs9_NIL_C_600 PDB CREDO	0.617	0.159	0.523	0.008
Rv2922c.2	2	2ab2_SNL_B_503 PDB CREDO	0.626	0.149	0.523	0.008
Rv2922c.1	1	1s9p_DES_C_500 PDB CREDO	0.616	0.160	0.522	0.008
Rv2922c.1	1	3vkx_T3_A_301 PDB CREDO	0.655	0.120	0.522	0.008
Rv2922c.1	1	2itz_IRE_A_2021 PDB CREDO	0.590	0.191	0.521	0.008
Rv2922c.1	1	2uxo_TAC_B_1211 PDB CREDO	0.590	0.191	0.521	0.008
Rv2922c.1	1	1g50_EST_B_1600 PDB CREDO	0.595	0.185	0.521	0.008
Rv2922c.1	1	2ity_IRE_A_2020 PDB CREDO	0.614	0.162	0.521	0.008
Rv2922c.2	2	2aoh_FRD_C_305 PDB CREDO	0.568	0.219	0.520	0.008
Rv2922c.1	1	1ere_EST_A_600 PDB CREDO	0.594	0.186	0.520	0.008
Rv2922c.1	1	1ere_EST_B_600 PDB CREDO	0.594	0.186	0.520	0.008
Rv2922c.1	1	1ere_EST_E_600 PDB CREDO	0.594	0.186	0.520	0.008
Rv2922c.2	2	3mnp_DEX_A_784 PDB CREDO	0.603	0.175	0.520	0.008
Rv2922c.1	1	1s9p_DES_B_459 PDB CREDO	0.612	0.164	0.519	0.008
Rv2922c.2	2	1y0x_T44_X_500 PDB CREDO	0.584	0.199	0.518	0.008
Rv2922c.1	1	1qku_EST_A_600 PDB CREDO	0.592	0.189	0.518	0.008
Rv2922c.2	2	3cs9_NIL_D_600 PDB CREDO	0.611	0.166	0.518	0.008
Rv2922c.1	1	2w8y_NDR_B_1000 PDB CREDO	0.611	0.167	0.518	0.008
Rv2922c.2	2	2oax_SNL_B_2001 PDB CREDO	0.620	0.156	0.517	0.008
Rv2922c.2	2	3mno_DEX_A_784 PDB CREDO	0.600	0.178	0.517	0.008
Rv2922c.1	1	1qku_EST_C_600 PDB CREDO	0.591	0.190	0.517	0.008
Rv2922c.2	2	1xzx_T3_X_500 PDB CREDO	0.639	0.135	0.517	0.008
Rv2922c.2	2	2hw2_RFP_A_1200 PDB CREDO	0.619	0.157	0.517	0.008
Rv2922c.2	2	1c6z_ROC_B_505 PDB CREDO	0.693	0.086	0.517	0.008
Rv2922c.2	2	1sgu_MK1_B_2632 PDB CREDO	0.516	0.293	0.516	0.009
Rv2922c.2	2	2r5q_1UN_D_900 PDB CREDO	0.532	0.270	0.516	0.009
Rv2922c.1	1	1qku_EST_B_600 PDB CREDO	0.590	0.191	0.516	0.009
Rv2922c.2	2	2oax_SNL_C_3001 PDB CREDO	0.618	0.158	0.516	0.009
Rv2922c.2	2	3vhu_SNL_A_1001 PDB CREDO	0.617	0.159	0.515	0.009
Rv2922c.2	2	3oht_1N1_B_1000 PDB CREDO	0.778	0.034	0.514	0.009
Rv2922c.1	1	1rv7_AB1_B_1001 PDB CREDO	0.559	0.232	0.514	0.009
Rv2922c.2	2	3rgf_BAX_A_465 PDB CREDO	0.528	0.275	0.513	0.009
Rv2922c.2	2	2h42_VIA_A_901 PDB CREDO	0.725	0.063	0.513	0.009
Rv2922c.2	2	2r5q_1UN_B_900 PDB CREDO	0.529	0.275	0.513	0.009
Rv2922c.1	1	2uxp_CLM_A_1211 PDB CREDO	0.587	0.195	0.513	0.009
Rv2922c.2	2	3hec_STI_A_1 PDB CREDO	0.615	0.162	0.513	0.009
Rv2922c.1	1	3hm1_J3Z_A_2 PDB CREDO	0.586	0.197	0.512	0.009
Rv2922c.2	2	3q70_RIT_A_2001 PDB CREDO	0.559	0.232	0.512	0.009
Rv2922c.2	2	1a28_STR_B_2 PDB CREDO	0.630	0.145	0.510	0.009
Rv2922c.1	1	2uxp_CLM_B_1211 PDB CREDO	0.582	0.201	0.510	0.009
Rv2922c.2	2	3uvv_T3_A_501 PDB CREDO	0.629	0.146	0.509	0.010
Rv2922c.2	2	2v0z_C41_O_1327 PDB CREDO	0.617	0.160	0.509	0.010
Rv2922c.1	1	1sn0_T44_C_601 PDB CREDO	0.555	0.238	0.508	0.010
Rv2922c.1	1	3grv_ADN_A_300 PDB CREDO	0.608	0.170	0.508	0.010
Rv2922c.1	1	3ug2_IRE_A_1 PDB CREDO	0.670	0.106	0.508	0.010
Rv2922c.1	1	2zva_1N1_A_513 PDB CREDO	0.599	0.181	0.507	0.010
Rv2922c.1	1	2bxf_DZP_B_2001 PDB CREDO	0.578	0.206	0.506	0.010
Rv2922c.1	1	2w9s_TOP_D_1158 PDB CREDO	0.527	0.277	0.505	0.010
Rv2922c.1	1	1pcg_EST_B_2 PDB CREDO	0.577	0.207	0.505	0.010
Rv2922c.2	2	2xkw_P1B_A_1478 PDB CREDO	0.644	0.130	0.505	0.010
Rv2922c.1	1	3oht_1N1_A_1000 PDB CREDO	0.668	0.108	0.505	0.010
Rv2922c.1	1	3sxr_1N1_B_2 PDB CREDO	0.572	0.215	0.504	0.010
Rv2922c.2	2	3rif_IVM_A_403 PDB CREDO	0.791	0.028	0.504	0.010
Rv2922c.2	2	2fxd_DR7_A_102 PDB CREDO	0.579	0.205	0.504	0.010
Rv2922c.2	2	1bsx_T3_A_1 PDB CREDO	0.643	0.131	0.504	0.010
Rv2922c.2	2	1bsx_T3_B_2 PDB CREDO	0.643	0.131	0.504	0.010
Rv2922c.2	2	3gws_T3_X_500 PDB CREDO	0.642	0.132	0.503	0.010
Rv2922c.2	2	1qkn_RAL_A_600 PDB CREDO	0.641	0.133	0.502	0.011
Rv2922c.2	2	3kk6_CEL_B_1701 PDB CREDO	0.561	0.229	0.502	0.011
Rv2922c.1	1	3qlg_1N1_A_601 PDB CREDO	0.615	0.161	0.502	0.011
Rv2922c.1	1	1gwr_EST_B_600 PDB CREDO	0.573	0.213	0.501	0.011
Rv2922c.1	1	2bxf_DZP_A_2001 PDB CREDO	0.573	0.213	0.501	0.011
Rv2922c.1	1	3uq6_ADN_B_401 PDB CREDO	0.600	0.179	0.501	0.011
Rv2922c.2	2	3bjw_SVR_E_503 PDB CREDO	0.576	0.209	0.501	0.011
Rv2922c.2	2	3rif_IVM_A_402 PDB CREDO	0.786	0.030	0.501	0.011
Rv2922c.1	2	3r9c_ECL_A_452 PDB CREDO	0.501	0.317	0.501	0.011
Rv2922c.1	1	3g5d_1N1_B_1 PDB CREDO	0.614	0.162	0.501	0.011
Rv2922c.2	2	3jwq_VIA_D_901 PDB CREDO	0.707	0.076	0.501	0.011
Rv2922c.2	2	3ria_IVM_C_349 PDB CREDO	0.785	0.031	0.501	0.011
Rv2922c.1	1	1sn5_T3_D_602 PDB CREDO	0.546	0.249	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions