SInCRe - Rv2613c

Tuberculist information

Gene name	Rv2613c
Protein function	Conserved protein
Functional category(tuberculist)	lipid metabolism
Gene location(kb)	2940.61
Molecular mass(da)	21836.7
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 195

	  		  	1    VSDEDRTDRATEDHTIFDRGVGQRDQLQRLWTPYRMNYLAEAPVKRDPNSSASPAQPFTE   60
			  	61   IPQLSDEEGLVVARGKLVYAVLNLYPYNPGHLMVVPYRRVSELEDLTDLESAELMAFTQK  120
			  	121  AIRVIKNVSRPHGFNVGLNLGTSAGGSLAEHLHVHVVPRWGGDANFITIIGGSKVIPQLL  180
			  	181  RDTRRLLATEWARQP

Known structures in the PDB

	PDB ID	3ANO
	Total residue count	436
	Number of chains	2
	Method	X-RAY
	Resolution	1.89

Number of amino acids : 195

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
HIT	PF01230	65-161

Mtb Structural Proteome models

Model Number	1
Model name	Rv2613c
Template	1FIT APDB CREDO
Template coverage	4_147
Template Identity(%)	28.2
Model coverage(%)	67.7
Normalized DOPE score	-0.442

Model Number	2
Model name	Rv2613c.1
Template	1GUP APDB CREDO
Template coverage	149_333
Template Identity(%)	17.3
Model coverage(%)	94.4
Normalized DOPE score	0.411

Structure Models from Chopin

Model Number	1
Profile	d.13.1.1 - 3.30.428.10 Click for model details
zscore	14.97
Residue begin	8
Residue end	195

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2613c	Gene name	Confidence Score
Rv2611c	Rv2611c	0.977
Rv2612c	pgsA1	0.977
Rv2609c	Rv2609c	0.971
Rv2610c	pimA	0.968
Rv2610c	pimA	0.968
Rv2614c	thrS	0.904
Rv2614c	thrS	0.904
Rv2614c	thrS	0.904

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2613c.1	5	1lhv_NOG_A_301 PDB CREDO	0.694	0.085	0.632	0.001
Rv2613c.1	5	2nni_MTK_A_501 PDB CREDO	0.690	0.089	0.630	0.001
Rv2613c.1	5	3d91_REM_A_350 PDB CREDO	0.661	0.114	0.622	0.001
Rv2613c.1	5	3d91_REM_B_350 PDB CREDO	0.655	0.120	0.616	0.002
Rv2613c.1	5	3h52_486_D_2 PDB CREDO	0.615	0.161	0.615	0.002
Rv2613c.1	5	3q70_RIT_A_2001 PDB CREDO	0.633	0.142	0.614	0.002
Rv2613c.1	5	1uwh_BAX_A_1723 PDB CREDO	0.612	0.165	0.612	0.002
Rv2613c.1	5	1uwh_BAX_B_1723 PDB CREDO	0.612	0.165	0.612	0.002
Rv2613c.1	5	2ab2_SNL_B_503 PDB CREDO	0.649	0.125	0.610	0.002
Rv2613c.1	5	2ab2_SNL_A_502 PDB CREDO	0.649	0.126	0.610	0.002
Rv2613c.1	5	1sa1_POD_D_701 PDB CREDO	0.627	0.148	0.608	0.002
Rv2613c.1	5	2oax_SNL_C_3001 PDB CREDO	0.646	0.129	0.607	0.002
Rv2613c.1	5	3tne_RIT_A_401 PDB CREDO	0.645	0.130	0.606	0.002
Rv2613c.1	5	3vhu_SNL_A_1001 PDB CREDO	0.645	0.130	0.606	0.002
Rv2613c.1	5	2oax_SNL_E_5001 PDB CREDO	0.623	0.153	0.604	0.002
Rv2613c.1	5	2oax_SNL_B_2001 PDB CREDO	0.643	0.132	0.604	0.002
Rv2613c.1	5	2oax_SNL_D_4001 PDB CREDO	0.622	0.153	0.604	0.002
Rv2613c.1	5	3h52_486_B_1 PDB CREDO	0.622	0.153	0.604	0.002
Rv2613c.1	5	2oax_SNL_F_6001 PDB CREDO	0.622	0.154	0.603	0.002
Rv2613c.1	5	3ut5_LOC_B_502 PDB CREDO	0.603	0.175	0.603	0.002
Rv2613c.1	5	1z2b_VLB_C_800 PDB CREDO	0.620	0.156	0.602	0.002
Rv2613c.1	5	2oax_SNL_A_1001 PDB CREDO	0.620	0.156	0.601	0.002
Rv2613c.1	5	3tkd_CYZ_B_267 PDB CREDO	0.599	0.180	0.599	0.002
Rv2613c.1	5	3mnp_DEX_A_784 PDB CREDO	0.617	0.159	0.598	0.002
Rv2613c.1	5	3ut5_LOC_D_502 PDB CREDO	0.636	0.139	0.598	0.002
Rv2613c.1	5	3mno_DEX_A_784 PDB CREDO	0.615	0.161	0.597	0.002
Rv2613c.1	5	1sa1_POD_B_700 PDB CREDO	0.633	0.142	0.596	0.002
Rv2613c.1	5	3so9_017_A_100 PDB CREDO	0.589	0.192	0.589	0.003
Rv2613c.1	5	3h52_486_A_3 PDB CREDO	0.582	0.201	0.582	0.003
Rv2613c.1	5	1uwj_BAX_B_1723 PDB CREDO	0.616	0.161	0.580	0.003
Rv2613c.1	5	3mne_DEX_A_784 PDB CREDO	0.657	0.117	0.579	0.003
Rv2613c.1	5	3rif_IVM_B_403 PDB CREDO	0.801	0.025	0.575	0.003
Rv2613c.1	5	1uwj_BAX_A_1723 PDB CREDO	0.666	0.110	0.575	0.003
Rv2613c.1	5	1p93_DEX_C_3999 PDB CREDO	0.652	0.123	0.574	0.003
Rv2613c.1	5	3ri5_IVM_C_350 PDB CREDO	0.800	0.025	0.574	0.003
Rv2613c.1	5	1p93_DEX_D_4999 PDB CREDO	0.651	0.123	0.574	0.003
Rv2613c.1	5	3ria_IVM_C_349 PDB CREDO	0.799	0.025	0.573	0.003
Rv2613c.1	5	3gn8_DEX_B_247 PDB CREDO	0.650	0.125	0.573	0.003
Rv2613c.1	5	3rif_IVM_D_402 PDB CREDO	0.797	0.026	0.572	0.003
Rv2613c.1	5	3rif_IVM_A_402 PDB CREDO	0.797	0.026	0.572	0.003
Rv2613c.1	5	1m2z_DEX_A_301 PDB CREDO	0.646	0.128	0.570	0.004
Rv2613c.1	5	3gn8_DEX_A_247 PDB CREDO	0.646	0.129	0.569	0.004
Rv2613c.1	5	3frq_ERY_B_195 PDB CREDO	0.604	0.174	0.568	0.004
Rv2613c.1	5	2aa5_STR_B_302 PDB CREDO	0.665	0.110	0.567	0.004
Rv2613c.1	5	3rif_IVM_A_403 PDB CREDO	0.790	0.029	0.567	0.004
Rv2613c.1	5	1m2z_DEX_D_401 PDB CREDO	0.642	0.132	0.566	0.004
Rv2613c.1	5	2aa6_STR_A_401 PDB CREDO	0.663	0.112	0.566	0.004
Rv2613c.1	5	2aa6_STR_B_402 PDB CREDO	0.663	0.112	0.566	0.004
Rv2613c.1	5	2aax_PDN_B_503 PDB CREDO	0.662	0.113	0.565	0.004
Rv2613c.1	5	2aax_PDN_A_502 PDB CREDO	0.662	0.113	0.565	0.004
Rv2613c.1	5	2aa5_STR_A_301 PDB CREDO	0.660	0.115	0.563	0.004
Rv2613c.1	5	1jg2_ADN_A_500 PDB CREDO	0.730	0.060	0.562	0.004
Rv2613c.1	5	3tkd_CYZ_A_266 PDB CREDO	0.598	0.181	0.562	0.004
Rv2613c.1	5	3bbt_FMM_D_91 PDB CREDO	0.703	0.078	0.561	0.004
Rv2613c.1	5	1a28_STR_B_2 PDB CREDO	0.615	0.161	0.560	0.004
Rv2613c.1	5	3e22_LOC_B_700 PDB CREDO	0.596	0.184	0.560	0.004
Rv2613c.1	5	3e22_LOC_D_700 PDB CREDO	0.595	0.185	0.559	0.004
Rv2613c.1	5	3tne_RIT_B_401 PDB CREDO	0.595	0.185	0.559	0.004
Rv2613c.1	5	2w8y_486_A_1000 PDB CREDO	0.594	0.186	0.559	0.004
Rv2613c.1	5	2h42_VIA_A_901 PDB CREDO	0.696	0.084	0.555	0.005
Rv2613c.1	5	3frq_ERY_A_195 PDB CREDO	0.604	0.174	0.552	0.005
Rv2613c.1	5	2y6o_1N1_A_1892 PDB CREDO	0.605	0.173	0.551	0.005
Rv2613c.1	5	3spk_TPV_B_100 PDB CREDO	0.600	0.179	0.549	0.005
Rv2613c.1	5	1p93_DEX_B_2999 PDB CREDO	0.683	0.095	0.545	0.005
Rv2613c.1	5	1nhz_486_A_800 PDB CREDO	0.657	0.118	0.542	0.006
Rv2613c.1	5	1p93_DEX_A_1999 PDB CREDO	0.680	0.097	0.542	0.006
Rv2613c.1	6	1xkk_FMM_A_91 PDB CREDO	0.854	0.009	0.540	0.006
Rv2613c.1	6	3sm2_478_A_126 PDB CREDO	0.811	0.021	0.539	0.006
Rv2613c.1	5	1ya3_STR_A_1001 PDB CREDO	0.699	0.081	0.539	0.006
Rv2613c.1	5	1ya3_STR_B_2001 PDB CREDO	0.699	0.082	0.538	0.006
Rv2613c.1	5	3ria_IVM_A_348 PDB CREDO	0.835	0.014	0.536	0.006
Rv2613c.1	5	3rhw_IVM_D_349 PDB CREDO	0.833	0.014	0.535	0.006
Rv2613c.1	5	3ria_IVM_E_348 PDB CREDO	0.833	0.014	0.535	0.006
Rv2613c.1	5	3rif_IVM_E_402 PDB CREDO	0.832	0.015	0.535	0.006
Rv2613c.1	5	3rhw_IVM_B_348 PDB CREDO	0.832	0.015	0.534	0.006
Rv2613c.1	5	3rhw_IVM_B_349 PDB CREDO	0.831	0.015	0.534	0.006
Rv2613c.1	5	3rhw_IVM_D_348 PDB CREDO	0.831	0.015	0.534	0.006
Rv2613c.1	5	3ria_IVM_C_350 PDB CREDO	0.831	0.015	0.534	0.006
Rv2613c.1	5	1jg3_ADN_A_500 PDB CREDO	0.770	0.037	0.533	0.007
Rv2613c.1	5	3ri5_IVM_B_349 PDB CREDO	0.829	0.015	0.533	0.007
Rv2613c.1	5	3ri5_IVM_D_349 PDB CREDO	0.829	0.015	0.533	0.007
Rv2613c.1	6	3oxc_ROC_A_401 PDB CREDO	0.590	0.191	0.531	0.007
Rv2613c.1	5	3ri5_IVM_A_349 PDB CREDO	0.827	0.016	0.531	0.007
Rv2613c.1	5	3ria_IVM_E_349 PDB CREDO	0.827	0.016	0.531	0.007
Rv2613c.1	5	3rhw_IVM_A_348 PDB CREDO	0.826	0.016	0.531	0.007
Rv2613c.1	5	3jwq_VIA_D_901 PDB CREDO	0.661	0.114	0.527	0.007
Rv2613c.1	5	3spk_TPV_A_100 PDB CREDO	0.638	0.137	0.526	0.007
Rv2613c.1	5	3b0w_DGX_A_1 PDB CREDO	0.559	0.232	0.526	0.007
Rv2613c.1	5	4asd_BAX_A_1500 PDB CREDO	0.555	0.237	0.522	0.008
Rv2613c.1	5	2v0z_C41_O_1327 PDB CREDO	0.712	0.072	0.522	0.008
Rv2613c.1	6	2q64_1UN_B_1001 PDB CREDO	0.766	0.040	0.522	0.008
Rv2613c.1	6	3ndt_ROC_A_101 PDB CREDO	0.532	0.270	0.521	0.008
Rv2613c.1	5	1lhu_EST_A_301 PDB CREDO	0.700	0.081	0.521	0.008
Rv2613c.1	6	2pym_1UN_A_1001 PDB CREDO	0.764	0.040	0.521	0.008
Rv2613c.1	6	2qak_1UN_A_1001 PDB CREDO	0.763	0.041	0.520	0.008
Rv2613c.1	5	3k54_1N1_A_1 PDB CREDO	0.751	0.047	0.520	0.008
Rv2613c.1	6	2pyn_1UN_A_1001 PDB CREDO	0.761	0.042	0.519	0.008
Rv2613c.1	5	2q1v_PDN_A_248 PDB CREDO	0.673	0.103	0.518	0.008
Rv2613c.1	6	2q63_1UN_A_1001 PDB CREDO	0.760	0.043	0.518	0.008
Rv2613c.1	6	3k4v_ROC_B_201 PDB CREDO	0.539	0.259	0.518	0.008
Rv2613c.1	5	3oct_1N1_A_663 PDB CREDO	0.668	0.107	0.515	0.009
Rv2613c.1	5	1t46_STI_A_3 PDB CREDO	0.684	0.093	0.515	0.009
Rv2613c.1	6	3gp0_NIL_A_1 PDB CREDO	0.833	0.014	0.513	0.009
Rv2613c.1	5	2x9g_LYA_A_1270 PDB CREDO	0.561	0.229	0.511	0.009
Rv2613c.1	5	1n49_RIT_D_401 PDB CREDO	0.575	0.210	0.511	0.009
Rv2613c.1	5	3pww_ROC_A_1001 PDB CREDO	0.678	0.098	0.511	0.009
Rv2613c.1	5	1fm6_BRL_X_504 PDB CREDO	0.560	0.231	0.510	0.009
Rv2613c.1	5	1mx1_THA_C_3 PDB CREDO	0.685	0.093	0.510	0.009
Rv2613c.1	5	1xkk_FMM_A_91 PDB CREDO	0.712	0.072	0.509	0.010
Rv2613c.1	5	3oht_1N1_B_1000 PDB CREDO	0.683	0.094	0.508	0.010
Rv2613c.1	5	3sm2_478_A_126 PDB CREDO	0.748	0.049	0.508	0.010
Rv2613c.1	5	1uob_PNN_A_1311 PDB CREDO	0.523	0.283	0.507	0.010
Rv2613c.1	5	1y0x_T44_X_500 PDB CREDO	0.507	0.307	0.507	0.010
Rv2613c.1	5	2jfa_RAL_A_600 PDB CREDO	0.540	0.259	0.507	0.010
Rv2613c.1	5	2ito_IRE_A_2020 PDB CREDO	0.788	0.029	0.506	0.010
Rv2613c.1	5	3h52_486_C_4 PDB CREDO	0.703	0.079	0.504	0.010
Rv2613c.1	5	1hwk_117_B_1 PDB CREDO	0.568	0.220	0.504	0.010
Rv2613c.1	5	2fum_MIX_D_3539 PDB CREDO	0.631	0.144	0.503	0.010
Rv2613c.1	5	2gqg_1N1_B_502 PDB CREDO	0.589	0.192	0.503	0.010
Rv2613c.1	5	2hw2_RFP_A_1200 PDB CREDO	0.534	0.266	0.502	0.011
Rv2613c.1	5	3d90_NOG_A_1001 PDB CREDO	0.608	0.169	0.502	0.011
Rv2613c.1	5	2h42_VIA_C_903 PDB CREDO	0.699	0.082	0.502	0.011
Rv2613c.1	6	3tkg_ROC_B_801 PDB CREDO	0.534	0.267	0.501	0.011
Rv2613c.1	5	3d90_NOG_B_2001 PDB CREDO	0.607	0.171	0.501	0.011
Rv2613c.1	5	2jfa_RAL_B_600 PDB CREDO	0.516	0.294	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions