SInCRe - Rv2609c

Tuberculist information

Gene name	Rv2609c
Protein function	Probable conserved membrane protein
Functional category(tuberculist)	cell wall and cell processes
Gene location(kb)	2936.81
Molecular mass(da)	38096.4
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 351

	  		  	1    MTWLVLAGAVLLVVLVAFGAWGYQTANRLNRLNVRYDLSWQSLDSALARRAVVARAVAID   60
			  	61   AYGGAPQGSRLAALADAAEGAPRHARENAENELSAALAMVNPASLPAALIAELADAEARV  120
			  	121  LLARRFHNDAVRDTLALGERRLVRLLRLGGTAVLPTYFEIVERPHALVHGDQGASGRRTS  180
			  	181  ARVVLLDDSGAVLLLCGSDPANPAFRDGAAPKWWFTVGGQVRPGERLAQAAARELAEETG  240
			  	241  LRVAPADMIGPIWRRDEVFEFNGSLIDSEEFYLVHRTRRFEPAVQGRTELERRYIRDARW  300
			  	301  CDANDIAQLVAAGERVYPLQLGELLPAANRLVDVALDNGAARDAGVPQPIR

Known structures in the PDB

No Known structures

Number of amino acids : 351

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
NUDIX	PF00293	177-324

Mtb Structural Proteome models

Model Number	1
Model name	Rv2609c.1
Template	2ETD APDB CREDO
Template coverage	35_157
Template Identity(%)	28.3
Model coverage(%)	29.9
Normalized DOPE score	-0.05

Model Number	2
Model name	Rv2609c
Template	1MK1 APDB CREDO
Template coverage	47_191
Template Identity(%)	23.0
Model coverage(%)	47.3
Normalized DOPE score	0.497

Structure Models from Chopin

Model Number	1
Profile	3.90.79.10 Click for model details
zscore	11.76
Residue begin	154
Residue end	351

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2609c	Gene name	Confidence Score
Rv2610c	pimA	0.977
Rv2610c	pimA	0.977
Rv2611c	Rv2611c	0.971
Rv2613c	Rv2613c	0.971
Rv2612c	pgsA1	0.96

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2609c.1	1	3ufn_ROC_A_401 PDB CREDO	0.752	0.046	0.657	0.001
Rv2609c.1	1	3el0_1UN_A_201 PDB CREDO	0.647	0.128	0.647	0.001
Rv2609c.1	1	1n49_RIT_D_401 PDB CREDO	0.675	0.101	0.638	0.001
Rv2609c.1	1	2qxs_RAL_B_600 PDB CREDO	0.665	0.110	0.630	0.001
Rv2609c.1	1	2qxs_RAL_A_600 PDB CREDO	0.663	0.112	0.627	0.001
Rv2609c.1	1	1n49_RIT_B_301 PDB CREDO	0.644	0.131	0.626	0.001
Rv2609c.1	1	3lzv_017_A_200 PDB CREDO	0.622	0.154	0.622	0.001
Rv2609c.1	1	2aoj_FRD_C_305 PDB CREDO	0.665	0.110	0.611	0.002
Rv2609c.1	1	3el5_1UN_B_201 PDB CREDO	0.744	0.051	0.602	0.002
Rv2609c.1	1	3bvb_017_B_401 PDB CREDO	0.791	0.028	0.594	0.002
Rv2609c.1	1	3ekt_017_B_200 PDB CREDO	0.660	0.115	0.592	0.002
Rv2609c.1	1	2f80_017_B_301 PDB CREDO	0.742	0.052	0.585	0.003
Rv2609c.1	1	3ogp_017_B_200 PDB CREDO	0.615	0.161	0.581	0.003
Rv2609c.1	1	3ekp_478_C_200 PDB CREDO	0.630	0.145	0.580	0.003
Rv2609c.1	1	2aoi_FRD_C_305 PDB CREDO	0.734	0.057	0.579	0.003
Rv2609c.1	1	2aoh_FRD_C_305 PDB CREDO	0.669	0.107	0.579	0.003
Rv2609c.1	1	3s56_ROC_A_201 PDB CREDO	0.619	0.157	0.570	0.004
Rv2609c.1	2	2y7j_B49_C_1294 PDB CREDO	0.596	0.184	0.567	0.004
Rv2609c.1	1	3ekp_478_B_200 PDB CREDO	0.596	0.184	0.563	0.004
Rv2609c.1	1	3spk_TPV_B_100 PDB CREDO	0.608	0.169	0.558	0.004
Rv2609c.1	1	3so9_017_A_100 PDB CREDO	0.665	0.110	0.558	0.004
Rv2609c.1	1	3ekq_ROC_A_100 PDB CREDO	0.589	0.193	0.557	0.004
Rv2609c.1	1	3oxv_478_B_200 PDB CREDO	0.571	0.215	0.556	0.005
Rv2609c.1	2	1pg2_ADN_A_552 PDB CREDO	0.641	0.133	0.554	0.005
Rv2609c.1	1	2qak_1UN_A_1001 PDB CREDO	0.701	0.080	0.553	0.005
Rv2609c.1	1	2q64_1UN_B_1001 PDB CREDO	0.699	0.081	0.552	0.005
Rv2609c.1	1	3ogq_AB1_A_200 PDB CREDO	0.664	0.111	0.551	0.005
Rv2609c.1	1	2pyn_1UN_A_1001 PDB CREDO	0.698	0.082	0.551	0.005
Rv2609c.1	1	2q63_1UN_A_1001 PDB CREDO	0.698	0.083	0.550	0.005
Rv2609c.1	1	2pym_1UN_A_1001 PDB CREDO	0.694	0.086	0.547	0.005
Rv2609c.1	1	3h52_486_A_3 PDB CREDO	0.652	0.123	0.547	0.005
Rv2609c.1	1	3d1y_ROC_A_201 PDB CREDO	0.710	0.073	0.547	0.005
Rv2609c.1	1	3oxw_017_D_200 PDB CREDO	0.558	0.232	0.543	0.006
Rv2609c.1	1	3ekx_1UN_B_201 PDB CREDO	0.654	0.120	0.543	0.006
Rv2609c.1	1	2r5q_1UN_B_900 PDB CREDO	0.591	0.190	0.543	0.006
Rv2609c.1	2	2x1l_ADN_A_601 PDB CREDO	0.571	0.216	0.542	0.006
Rv2609c.1	1	2r5q_1UN_D_900 PDB CREDO	0.590	0.191	0.542	0.006
Rv2609c.1	1	3ogp_017_A_200 PDB CREDO	0.626	0.149	0.541	0.006
Rv2609c.1	1	3oxw_017_B_200 PDB CREDO	0.554	0.238	0.539	0.006
Rv2609c.1	1	3sm2_478_A_126 PDB CREDO	0.664	0.111	0.537	0.006
Rv2609c.1	1	2nnp_ROC_A_401 PDB CREDO	0.747	0.050	0.535	0.006
Rv2609c.1	1	2o4p_TPV_A_300 PDB CREDO	0.581	0.202	0.533	0.007
Rv2609c.1	1	3lzu_017_A_200 PDB CREDO	0.577	0.207	0.532	0.007
Rv2609c.1	1	1c6y_MK1_B_524 PDB CREDO	0.576	0.209	0.531	0.007
Rv2609c.1	1	1ya4_CTX_A_1 PDB CREDO	0.705	0.077	0.529	0.007
Rv2609c.1	1	3lzs_017_A_200 PDB CREDO	0.529	0.274	0.529	0.007
Rv2609c.1	1	3h52_486_B_1 PDB CREDO	0.611	0.166	0.529	0.007
Rv2609c.1	1	1ohr_1UN_A_201 PDB CREDO	0.574	0.212	0.528	0.007
Rv2609c.1	1	2idw_017_B_401 PDB CREDO	0.558	0.233	0.527	0.007
Rv2609c.1	1	3ekt_017_D_200 PDB CREDO	0.685	0.093	0.527	0.007
Rv2609c.1	1	3ggu_017_B_201 PDB CREDO	0.619	0.157	0.527	0.007
Rv2609c.1	1	1hpv_478_B_200 PDB CREDO	0.526	0.279	0.526	0.007
Rv2609c.1	2	2y7j_B49_D_1294 PDB CREDO	0.667	0.109	0.525	0.007
Rv2609c.1	1	3ttp_017_A_201 PDB CREDO	0.525	0.280	0.525	0.007
Rv2609c.1	1	3el4_ROC_A_100 PDB CREDO	0.730	0.060	0.522	0.008
Rv2609c.1	1	2aof_FRD_C_305 PDB CREDO	0.746	0.050	0.522	0.008
Rv2609c.1	1	2q5k_AB1_A_201 PDB CREDO	0.551	0.242	0.522	0.008
Rv2609c.1	1	3em6_017_A_200 PDB CREDO	0.521	0.286	0.521	0.008
Rv2609c.1	1	1hsh_MK1_A_401 PDB CREDO	0.565	0.223	0.520	0.008
Rv2609c.1	1	3nu9_478_A_401 PDB CREDO	0.520	0.287	0.520	0.008
Rv2609c.1	1	4dqc_017_A_101 PDB CREDO	0.550	0.244	0.520	0.008
Rv2609c.1	1	3nu6_478_B_401 PDB CREDO	0.546	0.249	0.517	0.008
Rv2609c.1	1	4dqe_017_B_101 PDB CREDO	0.530	0.273	0.515	0.009
Rv2609c.1	1	3h52_486_D_2 PDB CREDO	0.614	0.163	0.515	0.009
Rv2609c.1	1	3em3_478_B_200 PDB CREDO	0.621	0.155	0.515	0.009
Rv2609c.1	1	3n3i_ROC_A_201 PDB CREDO	0.529	0.275	0.514	0.009
Rv2609c.1	1	3s45_478_B_201 PDB CREDO	0.576	0.208	0.514	0.009
Rv2609c.1	1	1sgu_MK1_B_2632 PDB CREDO	0.543	0.253	0.513	0.009
Rv2609c.1	1	3oxv_478_C_200 PDB CREDO	0.572	0.214	0.513	0.009
Rv2609c.1	2	1yi4_ADN_A_306 PDB CREDO	0.569	0.218	0.513	0.009
Rv2609c.1	1	2nmy_ROC_A_401 PDB CREDO	0.783	0.031	0.511	0.009
Rv2609c.1	1	2w8y_486_A_1000 PDB CREDO	0.573	0.212	0.511	0.009
Rv2609c.1	1	3s53_017_A_201 PDB CREDO	0.525	0.280	0.511	0.009
Rv2609c.1	1	1k6c_MK1_B_902 PDB CREDO	0.713	0.071	0.510	0.009
Rv2609c.1	1	3gp0_NIL_A_1 PDB CREDO	0.584	0.199	0.510	0.009
Rv2609c.1	1	3nuo_478_B_478 PDB CREDO	0.581	0.202	0.508	0.010
Rv2609c.1	2	2y7j_B49_A_1294 PDB CREDO	0.615	0.161	0.507	0.010
Rv2609c.1	1	3nu4_478_B_401 PDB CREDO	0.565	0.223	0.507	0.010
Rv2609c.1	2	2x1l_ADN_C_601 PDB CREDO	0.642	0.132	0.506	0.010
Rv2609c.1	1	3pwm_017_B_402 PDB CREDO	0.673	0.103	0.506	0.010
Rv2609c.1	1	1sh9_RIT_B_301 PDB CREDO	0.548	0.247	0.505	0.010
Rv2609c.1	1	2jfa_RAL_B_600 PDB CREDO	0.620	0.156	0.504	0.010
Rv2609c.1	1	3tkg_ROC_C_901 PDB CREDO	0.738	0.055	0.504	0.010
Rv2609c.1	1	3ndu_ROC_D_100 PDB CREDO	0.755	0.045	0.504	0.010
Rv2609c.1	1	1rl8_RIT_A_9001 PDB CREDO	0.655	0.120	0.504	0.010
Rv2609c.1	1	1err_RAL_A_600 PDB CREDO	0.618	0.158	0.503	0.010
Rv2609c.1	1	3ucb_017_A_201 PDB CREDO	0.686	0.092	0.503	0.010
Rv2609c.1	1	3pwr_ROC_A_401 PDB CREDO	0.669	0.106	0.503	0.010
Rv2609c.1	1	3t3c_017_A_201 PDB CREDO	0.531	0.271	0.502	0.011
Rv2609c.1	1	3k4v_ROC_D_201 PDB CREDO	0.718	0.068	0.502	0.011
Rv2609c.1	1	4dqh_017_B_101 PDB CREDO	0.516	0.294	0.502	0.011
Rv2609c.1	1	1t7i_017_A_200 PDB CREDO	0.700	0.081	0.501	0.011
Rv2609c.1	1	2rkf_AB1_A_501 PDB CREDO	0.589	0.193	0.501	0.011
Rv2609c.1	1	1hxw_RIT_B_301 PDB CREDO	0.588	0.194	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions