SInCRe - Rv0884c

Tuberculist information

Gene name	serC
Protein function	Possible phosphoserine aminotransferase SerC (PSAT)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	981.424
Molecular mass(da)	40233.4
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 376

	  		  	1    MADQLTPHLEIPTAIKPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKNLVGR   60
			  	61   VRSGLAELFSLPDGYEVILGNGGATAFWDAAAFGLIDKRSLHLTYGEFSAKFASAVSKNP  120
			  	121  FVGEPIIITSDPGSAPEPQTDPSVDVIAWAHNETSTGVAVAVRRPEGSDDALVVIDATSG  180
			  	181  AGGLPVDIAETDAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIA  240
			  	241  VENSLKNQTYNTPAIATLALLAEQIDWLVGNGGLDWAVKRTADSSQRLYSWAQERPYTTP  300
			  	301  FVTDPGLRSQVVGTIDFVDDVDAGTVAKILRANGIVDTEPYRKLGRNQLRVAMFPAVEPD  360
			  	361  DVSALTECVDWVVERL

Known structures in the PDB

	PDB ID	2FYF
	Total residue count	796
	Number of chains	2
	Method	X-RAY
	Resolution	1.5

	PDB ID	3VOM
	Total residue count	796
	Number of chains	2
	Method	X-RAY
	Resolution	2.1

Number of amino acids : 376

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Aminotran_5	PF00266	24-338

Mtb Structural Proteome models

Model Number	1
Model name	Rv0884c_2fyf_A
Template	2FYF APDB CREDO
Template coverage	8_376
Template Identity(%)	100.0
Model coverage(%)	97.9
Normalized DOPE score	-2.054

Model Number	2
Model name	Rv0884c
Template	2CH1 APDB CREDO
Template coverage	4_383
Template Identity(%)	19.8
Model coverage(%)	99.2
Normalized DOPE score	-0.265

Structure Models from Chopin

Model Number	1
Profile	c.67.1.3 Click for model details
zscore	13.56
Residue begin	1
Residue end	376

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0884c	Gene name	Confidence Score
Rv2996c	serA1	0.998
Rv2996c	serA1	0.998
Rv2996c	serA1	0.998
Rv3042c	serB2	0.994
Rv3042c	serB2	0.994
Rv0728c	serA2	0.989
Rv0728c	serA2	0.989
Rv0505c	serB1	0.933
Rv1295	thrC	0.927
Rv0885	Rv0885	0.926

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0884c_2fyf_A	8	2xpv_MIY_A_1209 PDB CREDO	0.605	0.173	0.584	0.003
Rv0884c_2fyf_A	8	3jwq_VIA_D_901 PDB CREDO	0.581	0.202	0.562	0.004
Rv0884c_2fyf_A	8	3frq_ERY_B_195 PDB CREDO	0.667	0.108	0.547	0.005
Rv0884c_2fyf_A	8	3e22_LOC_B_700 PDB CREDO	0.665	0.110	0.546	0.005
Rv0884c_2fyf_A	8	3e22_LOC_D_700 PDB CREDO	0.659	0.115	0.541	0.006
Rv0884c_2fyf_A	8	2h42_VIA_A_901 PDB CREDO	0.558	0.233	0.539	0.006
Rv0884c_2fyf_A	8	2h42_VIA_B_902 PDB CREDO	0.573	0.213	0.534	0.007
Rv0884c_2fyf_A	8	3ut5_LOC_D_502 PDB CREDO	0.649	0.125	0.532	0.007
Rv0884c_2fyf_A	8	1ya3_STR_A_1001 PDB CREDO	0.529	0.274	0.529	0.007
Rv0884c_2fyf_A	8	3jwq_VIA_B_901 PDB CREDO	0.566	0.223	0.527	0.007
Rv0884c_2fyf_A	8	1fm6_BRL_D_503 PDB CREDO	0.545	0.251	0.526	0.007
Rv0884c_2fyf_A	8	2prg_BRL_A_1 PDB CREDO	0.544	0.253	0.525	0.007
Rv0884c_2fyf_A	8	1ya3_STR_B_2001 PDB CREDO	0.522	0.284	0.522	0.008
Rv0884c_2fyf_A	23	1uay_ADN_B_1002 PDB CREDO	0.625	0.150	0.521	0.008
Rv0884c_2fyf_A	8	3qt0_486_A_4 PDB CREDO	0.538	0.260	0.520	0.008
Rv0884c_2fyf_A	8	2xpw_OTC_A_222 PDB CREDO	0.645	0.130	0.517	0.008
Rv0884c_2fyf_A	8	1p93_DEX_A_1999 PDB CREDO	0.535	0.266	0.517	0.008
Rv0884c_2fyf_A	8	1p93_DEX_B_2999 PDB CREDO	0.535	0.266	0.517	0.008
Rv0884c_2fyf_A	8	1ict_T44_D_129 PDB CREDO	0.669	0.107	0.516	0.009
Rv0884c_2fyf_A	8	2vke_TAC_A_222 PDB CREDO	0.641	0.133	0.514	0.009
Rv0884c_2fyf_A	8	1zgy_BRL_A_503 PDB CREDO	0.545	0.251	0.509	0.009
Rv0884c_2fyf_A	8	2aa5_STR_A_301 PDB CREDO	0.563	0.226	0.509	0.010
Rv0884c_2fyf_A	8	2h42_VIA_C_903 PDB CREDO	0.545	0.250	0.508	0.010
Rv0884c_2fyf_A	8	3frq_ERY_A_195 PDB CREDO	0.721	0.066	0.508	0.010
Rv0884c_2fyf_A	8	2q1v_PDN_A_248 PDB CREDO	0.506	0.309	0.506	0.010
Rv0884c_2fyf_A	8	2aa5_STR_B_302 PDB CREDO	0.560	0.231	0.505	0.010
Rv0884c_2fyf_A	8	3ut5_LOC_B_502 PDB CREDO	0.653	0.121	0.503	0.010
Rv0884c_2fyf_A	8	3bbt_FMM_D_91 PDB CREDO	0.518	0.291	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
L-serinePubChem	0.96	105.093
pyridoxal phosphatePubChem	0.95	247.142
3-phosphoglyceratePubChem	0.947	186.057
O-phosphoserinePubChem	0.926	185.072
phosphohydroxypyruvatePubChem	0.925	184.041
glycerolPubChem	0.922	92.0938
glutamatePubChem	0.909	147.129
alpha-ketoglutaratePubChem	0.905	146.098
2-oxo-3-hydroxy-4-phosphobutanoatePubChem	0.902	213.059
3-hydroxy-4-phospho-hydroxy-alpha-ketobutyratePubChem	0.902	213.059
D-erythronate-4-phosphatePubChem	0.901	215.075
sulfatePubChem	0.901	96.0626
C07335PubChem	0.9	213.083
reduced nicotinamide adenine dinucleotidePubChem	0.9	665.441
4TPPubChem	0.9	215.098
phosphatePubChem	0.9	96.9872
protiumPubChem	0.9	2.01576
H(+)PubChem	0.9	2.01588
cisplatinPubChem	0.9	298.029
NAD+PubChem	0.9	663.425
potassium tetrachloroplatinate(II)PubChem	0.9	415.087
hydroxyl radicalsPubChem	0.9	17.0073
CHEBI:16273PubChem	0.9	213.083
L-threo-3-hydroxy-homoserine phosphatePubChem	0.9	214.091
hydron sulfatePubChem	0.9	196.157
DL-serinePubChem	0.9	105.093
deuteriumPubChem	0.9	2.01588
dihydronicotinamide formycin dinucleotidePubChem	0.9	665.441