SInCRe - Rv0260c

Tuberculist information

Gene name	Rv0260c
Protein function	Possible transcriptional regulatory protein
Functional category(tuberculist)	regulatory proteins
Gene location(kb)	311.514
Molecular mass(da)	40732.7
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 381

	  		  	1    MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMIALPDDDELQNNTEAL   60
			  	61   IADPPDILVAHTGIGFRGWLAAAEGWGLANELLESLSSARIISRGPKATGALRAAGLREE  120
			  	121  WSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFPEFLGGLRFAGAQVVPIRVYR  180
			  	181  WKPAPLGGVFDHLVTGIARRQFDAVTFTSAPAAAAVLERSRELDIEDQLLAALRTDVHAM  240
			  	241  CVGPVTSRPLIRKGVPTSAPERMRLGALARHIAEELPLLGSCTFKAAGHVIEIRGTSVLV  300
			  	301  DDSVKPLSPSGMAILRALVHRPGGVVSRGDLLRVLPGDGSDTHAVDTAVLRLRTALGDKN  360
			  	361  IVATVVKRGYRLAVDSRHDDV

Known structures in the PDB

No Known structures

Number of amino acids : 381

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
HEM4	PF02602	23-270
Trans_reg_C	PF00486	302-372

Mtb Structural Proteome models

Model Number	1
Model name	Rv0260c.4
Template	1OPC APDB CREDO
Template coverage	137_235
Template Identity(%)	23.7
Model coverage(%)	24.1
Normalized DOPE score	-1.194

Model Number	2
Model name	Rv0260c.3
Template	1GXQ APDB CREDO
Template coverage	125_228
Template Identity(%)	25.3
Model coverage(%)	25.7
Normalized DOPE score	-0.695

Model Number	3
Model name	Rv0260c
Template	1WCW APDB CREDO
Template coverage	10_248
Template Identity(%)	35.6
Model coverage(%)	66.9
Normalized DOPE score	-0.308

Structure Models from Chopin

Model Number	1
Profile	c.113.1.1 Click for model details
zscore	29.04
Residue begin	23
Residue end	270

Model Number	2
Profile	a.4.6.1 - 1.10.10.10 Click for model details
zscore	21.23
Residue begin	302
Residue end	372

Model Number	3
Profile	a.4.6.1, c.23.1.1 - 1.10.10.10, 3.40.50.2300 Click for model details
zscore	12.53
Residue begin	175
Residue end	376

Model Number	4
Profile	a.4.6.1 - 1.10.10.10 Click for model details
zscore	12.21
Residue begin	277
Residue end	376

Model Number	5
Profile	3.40.50.10090 Click for model details
zscore	11.13
Residue begin	23
Residue end	139

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0260c	Gene name	Confidence Score
Rv2847c	cysG	0.968
Rv2847c	cysG	0.968
Rv2678c	hemE	0.95
Rv0510	hemC	0.929
Rv0510	hemC	0.929

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0260c.4	2	2ocf_EST_A_596 PDB CREDO	0.734	0.057	0.673	0.000
Rv0260c.4	2	2j7x_EST_A_1454 PDB CREDO	0.726	0.062	0.665	0.001
Rv0260c.4	2	1g50_EST_C_2600 PDB CREDO	0.725	0.063	0.664	0.001
Rv0260c.4	2	1a52_EST_A_1 PDB CREDO	0.724	0.064	0.663	0.001
Rv0260c.4	2	1a52_EST_B_2 PDB CREDO	0.721	0.066	0.660	0.001
Rv0260c.4	2	1pcg_EST_A_1 PDB CREDO	0.719	0.067	0.659	0.001
Rv0260c.4	2	1g50_EST_B_1600 PDB CREDO	0.686	0.092	0.656	0.001
Rv0260c.4	2	1ere_EST_C_600 PDB CREDO	0.715	0.070	0.655	0.001
Rv0260c.4	2	3oll_EST_B_600 PDB CREDO	0.715	0.070	0.655	0.001
Rv0260c.4	2	1qku_EST_B_600 PDB CREDO	0.685	0.093	0.655	0.001
Rv0260c.4	2	1ere_EST_D_600 PDB CREDO	0.714	0.070	0.654	0.001
Rv0260c.4	2	3oll_EST_A_600 PDB CREDO	0.714	0.070	0.654	0.001
Rv0260c.4	2	1qku_EST_A_600 PDB CREDO	0.684	0.094	0.654	0.001
Rv0260c.4	2	1qku_EST_C_600 PDB CREDO	0.683	0.095	0.653	0.001
Rv0260c.4	2	1qkt_EST_A_600 PDB CREDO	0.712	0.072	0.652	0.001
Rv0260c.4	2	3hm1_J3Z_B_1 PDB CREDO	0.712	0.072	0.652	0.001
Rv0260c.4	2	1ere_EST_F_600 PDB CREDO	0.710	0.073	0.650	0.001
Rv0260c.4	2	1ere_EST_E_600 PDB CREDO	0.679	0.098	0.648	0.001
Rv0260c.4	2	1ere_EST_A_600 PDB CREDO	0.678	0.099	0.647	0.001
Rv0260c.4	2	1ere_EST_B_600 PDB CREDO	0.678	0.099	0.647	0.001
Rv0260c.4	2	1pcg_EST_B_2 PDB CREDO	0.677	0.100	0.646	0.001
Rv0260c.4	2	1gwr_EST_B_600 PDB CREDO	0.673	0.103	0.643	0.001
Rv0260c.4	2	1gwr_EST_A_600 PDB CREDO	0.668	0.107	0.638	0.001
Rv0260c.3	2	3cs8_BRL_A_503 PDB CREDO	0.680	0.097	0.629	0.001
Rv0260c.4	2	3lfa_1N1_A_361 PDB CREDO	0.714	0.070	0.627	0.001
Rv0260c.3	5	1uay_ADN_A_1001 PDB CREDO	0.623	0.153	0.623	0.001
Rv0260c.4	3	3ug2_IRE_A_1 PDB CREDO	0.639	0.135	0.609	0.002
Rv0260c.4	2	3ols_EST_A_600 PDB CREDO	0.738	0.054	0.597	0.002
Rv0260c.4	2	3ols_EST_B_600 PDB CREDO	0.735	0.056	0.594	0.002
Rv0260c.4	2	1g50_EST_A_600 PDB CREDO	0.728	0.061	0.589	0.003
Rv0260c.4	2	3uud_EST_B_600 PDB CREDO	0.723	0.064	0.584	0.003
Rv0260c.4	2	3uud_EST_A_600 PDB CREDO	0.721	0.066	0.583	0.003
Rv0260c.4	3	1uay_ADN_A_1001 PDB CREDO	0.640	0.135	0.582	0.003
Rv0260c.4	2	2yja_EST_B_1550 PDB CREDO	0.720	0.066	0.582	0.003
Rv0260c.3	5	1sn0_T44_C_601 PDB CREDO	0.605	0.173	0.578	0.003
Rv0260c.4	2	1sn0_T44_C_601 PDB CREDO	0.568	0.220	0.568	0.004
Rv0260c.3	2	1fm6_BRL_D_503 PDB CREDO	0.657	0.117	0.568	0.004
Rv0260c.3	5	3ug2_IRE_A_1 PDB CREDO	0.655	0.120	0.568	0.004
Rv0260c.3	5	2uxp_CLM_B_1211 PDB CREDO	0.567	0.221	0.567	0.004
Rv0260c.3	2	2prg_BRL_A_1 PDB CREDO	0.655	0.119	0.566	0.004
Rv0260c.3	2	2xkw_P1B_B_1475 PDB CREDO	0.632	0.143	0.566	0.004
Rv0260c.4	1	3eor_CFV_A_901 PDB CREDO	0.563	0.226	0.563	0.004
Rv0260c.3	2	3qt0_486_A_4 PDB CREDO	0.697	0.083	0.561	0.004
Rv0260c.4	2	2j7y_E3O_A_1454 PDB CREDO	0.781	0.033	0.561	0.004
Rv0260c.4	7	3erd_DES_B_800 PDB CREDO	0.556	0.235	0.556	0.004
Rv0260c.4	7	3oht_1N1_B_1000 PDB CREDO	0.576	0.209	0.556	0.005
Rv0260c.3	5	2uxp_CLM_A_1211 PDB CREDO	0.555	0.237	0.555	0.005
Rv0260c.3	5	3hm1_J3Z_A_2 PDB CREDO	0.554	0.239	0.554	0.005
Rv0260c.3	5	3lfa_1N1_A_361 PDB CREDO	0.659	0.116	0.552	0.005
Rv0260c.4	3	2uxp_CLM_B_1211 PDB CREDO	0.606	0.172	0.552	0.005
Rv0260c.3	5	4dta_ADN_A_401 PDB CREDO	0.577	0.207	0.552	0.005
Rv0260c.4	3	4dta_ADN_A_401 PDB CREDO	0.634	0.141	0.552	0.005
Rv0260c.4	3	3ads_IMN_A_1 PDB CREDO	0.638	0.136	0.549	0.005
Rv0260c.3	5	3r9c_ECL_A_452 PDB CREDO	0.654	0.120	0.549	0.005
Rv0260c.4	2	3rem_SAL_B_301 PDB CREDO	0.696	0.084	0.548	0.005
Rv0260c.4	2	3hm1_J3Z_A_2 PDB CREDO	0.572	0.214	0.546	0.005
Rv0260c.4	3	3hm1_J3Z_A_2 PDB CREDO	0.599	0.180	0.545	0.005
Rv0260c.4	3	3s20_CER_B_1 PDB CREDO	0.544	0.253	0.544	0.006
Rv0260c.3	5	3rem_SAL_A_301 PDB CREDO	0.659	0.116	0.543	0.006
Rv0260c.3	5	3ads_IMN_B_3 PDB CREDO	0.621	0.155	0.543	0.006
Rv0260c.4	3	2uxp_CLM_A_1211 PDB CREDO	0.596	0.184	0.542	0.006
Rv0260c.4	1	3b9m_SAL_A_1100 PDB CREDO	0.542	0.256	0.542	0.006
Rv0260c.3	5	1r9o_FLP_A_501 PDB CREDO	0.540	0.258	0.540	0.006
Rv0260c.4	3	1sn0_T44_C_601 PDB CREDO	0.619	0.157	0.538	0.006
Rv0260c.4	7	2xkw_P1B_B_1475 PDB CREDO	0.538	0.262	0.538	0.006
Rv0260c.3	2	2uxo_TAC_B_1211 PDB CREDO	0.603	0.175	0.536	0.006
Rv0260c.3	5	3rf4_FUN_B_202 PDB CREDO	0.650	0.124	0.536	0.006
Rv0260c.3	5	3rem_SAL_B_301 PDB CREDO	0.649	0.126	0.535	0.006
Rv0260c.4	3	3ads_IMN_B_3 PDB CREDO	0.671	0.104	0.535	0.006
Rv0260c.3	5	1sn5_T3_D_602 PDB CREDO	0.559	0.231	0.534	0.006
Rv0260c.4	7	3oht_1N1_A_1000 PDB CREDO	0.574	0.211	0.534	0.006
Rv0260c.3	2	1zgy_BRL_A_503 PDB CREDO	0.685	0.093	0.533	0.007
Rv0260c.4	7	3lfa_1N1_A_361 PDB CREDO	0.727	0.062	0.532	0.007
Rv0260c.4	2	1ya4_CTX_C_3 PDB CREDO	0.685	0.093	0.532	0.007
Rv0260c.4	7	3erd_DES_A_600 PDB CREDO	0.531	0.271	0.531	0.007
Rv0260c.4	2	1ya4_CTX_B_2 PDB CREDO	0.684	0.094	0.531	0.007
Rv0260c.4	7	1s9p_DES_D_600 PDB CREDO	0.550	0.244	0.531	0.007
Rv0260c.3	5	3rf4_FUN_A_201 PDB CREDO	0.644	0.131	0.531	0.007
Rv0260c.3	2	2cbr_A80_A_201 PDB CREDO	0.551	0.243	0.530	0.007
Rv0260c.3	5	3rf4_FUN_C_203 PDB CREDO	0.642	0.132	0.530	0.007
Rv0260c.3	5	3s20_CER_B_1 PDB CREDO	0.582	0.201	0.530	0.007
Rv0260c.4	3	1r9o_FLP_A_501 PDB CREDO	0.578	0.206	0.526	0.007
Rv0260c.4	3	1sn0_T44_B_602 PDB CREDO	0.611	0.166	0.526	0.007
Rv0260c.4	3	1xbb_STI_A_1 PDB CREDO	0.552	0.241	0.526	0.007
Rv0260c.4	3	2x7h_PFN_A_1372 PDB CREDO	0.551	0.243	0.525	0.007
Rv0260c.4	7	3hec_STI_A_1 PDB CREDO	0.687	0.091	0.525	0.007
Rv0260c.3	2	3r9c_ECL_A_452 PDB CREDO	0.641	0.133	0.525	0.007
Rv0260c.4	7	3gcs_BAX_A_401 PDB CREDO	0.773	0.036	0.523	0.008
Rv0260c.4	3	3lfa_1N1_A_361 PDB CREDO	0.684	0.093	0.522	0.008
Rv0260c.4	2	1s9p_DES_B_459 PDB CREDO	0.671	0.105	0.521	0.008
Rv0260c.4	2	1s9p_DES_C_500 PDB CREDO	0.671	0.105	0.521	0.008
Rv0260c.4	7	1s9p_DES_A_459 PDB CREDO	0.540	0.259	0.521	0.008
Rv0260c.3	2	3q1e_T44_C_128 PDB CREDO	0.520	0.287	0.520	0.008
Rv0260c.4	2	1cqp_803_A_311 PDB CREDO	0.544	0.252	0.520	0.008
Rv0260c.4	3	3r9c_ECL_A_452 PDB CREDO	0.681	0.096	0.520	0.008
Rv0260c.4	3	1sn5_T3_D_602 PDB CREDO	0.597	0.183	0.519	0.008
Rv0260c.3	5	2x7h_PFN_A_1372 PDB CREDO	0.543	0.254	0.518	0.008
Rv0260c.4	7	2zva_1N1_A_513 PDB CREDO	0.625	0.150	0.518	0.008
Rv0260c.3	2	2h77_T3_A_1 PDB CREDO	0.665	0.110	0.518	0.008
Rv0260c.3	5	1gwr_EST_B_600 PDB CREDO	0.516	0.294	0.516	0.009
Rv0260c.3	2	3gws_T3_X_500 PDB CREDO	0.707	0.076	0.515	0.009
Rv0260c.4	7	3g5d_1N1_B_1 PDB CREDO	0.598	0.181	0.515	0.009
Rv0260c.4	7	3g5d_1N1_A_1 PDB CREDO	0.597	0.182	0.514	0.009
Rv0260c.3	5	1sn5_T3_C_601 PDB CREDO	0.613	0.164	0.514	0.009
Rv0260c.4	2	3rem_SAL_A_301 PDB CREDO	0.653	0.122	0.514	0.009
Rv0260c.4	7	2fum_MIX_D_3539 PDB CREDO	0.571	0.216	0.514	0.009
Rv0260c.3	2	1bsx_T3_A_1 PDB CREDO	0.705	0.077	0.513	0.009
Rv0260c.3	2	1bsx_T3_B_2 PDB CREDO	0.705	0.077	0.513	0.009
Rv0260c.4	7	3qlg_1N1_A_601 PDB CREDO	0.594	0.186	0.512	0.009
Rv0260c.4	2	3erd_DES_B_800 PDB CREDO	0.795	0.027	0.511	0.009
Rv0260c.4	3	3rem_SAL_A_301 PDB CREDO	0.564	0.225	0.511	0.009
Rv0260c.3	2	1s9p_DES_B_459 PDB CREDO	0.552	0.241	0.511	0.009
Rv0260c.3	5	2y7j_B49_A_1294 PDB CREDO	0.511	0.302	0.511	0.009
Rv0260c.4	2	1mx1_THA_B_2 PDB CREDO	0.605	0.173	0.509	0.009
Rv0260c.3	5	1pcg_EST_B_2 PDB CREDO	0.508	0.305	0.508	0.010
Rv0260c.3	2	1s9p_DES_C_500 PDB CREDO	0.549	0.245	0.508	0.010
Rv0260c.3	5	1g50_EST_B_1600 PDB CREDO	0.507	0.307	0.507	0.010
Rv0260c.3	5	1gwr_EST_A_600 PDB CREDO	0.507	0.307	0.507	0.010
Rv0260c.3	2	1hk1_T44_A_3001 PDB CREDO	0.620	0.156	0.507	0.010
Rv0260c.4	7	2yja_EST_B_1550 PDB CREDO	0.638	0.137	0.507	0.010
Rv0260c.4	7	3ols_EST_B_600 PDB CREDO	0.638	0.137	0.507	0.010
Rv0260c.4	7	3qlg_1N1_B_601 PDB CREDO	0.588	0.193	0.506	0.010
Rv0260c.3	5	1sn0_T44_B_602 PDB CREDO	0.646	0.128	0.506	0.010
Rv0260c.3	5	2uxo_TAC_B_1211 PDB CREDO	0.655	0.119	0.506	0.010
Rv0260c.4	7	1g50_EST_A_600 PDB CREDO	0.636	0.139	0.506	0.010
Rv0260c.4	7	3ols_EST_A_600 PDB CREDO	0.636	0.139	0.506	0.010
Rv0260c.4	7	3uud_EST_A_600 PDB CREDO	0.636	0.139	0.506	0.010
Rv0260c.4	7	3uud_EST_B_600 PDB CREDO	0.636	0.139	0.506	0.010
Rv0260c.3	2	1z9y_FUN_A_500 PDB CREDO	0.506	0.309	0.506	0.010
Rv0260c.3	2	3o1c_ADN_A_127 PDB CREDO	0.545	0.251	0.506	0.010
Rv0260c.3	2	3ln1_CEL_D_682 PDB CREDO	0.628	0.147	0.506	0.010
Rv0260c.3	5	1qku_EST_A_600 PDB CREDO	0.505	0.310	0.505	0.010
Rv0260c.4	3	1ie4_T44_A_128 PDB CREDO	0.689	0.090	0.504	0.010
Rv0260c.3	5	1qku_EST_C_600 PDB CREDO	0.504	0.312	0.504	0.010
Rv0260c.4	3	2eva_ADN_A_498 PDB CREDO	0.529	0.274	0.504	0.010
Rv0260c.4	3	1pg2_ADN_A_552 PDB CREDO	0.528	0.275	0.504	0.010
Rv0260c.4	7	3heg_BAX_A_1 PDB CREDO	0.723	0.065	0.503	0.010
Rv0260c.3	2	1gs4_ZK5_A_1918 PDB CREDO	0.562	0.227	0.503	0.010
Rv0260c.3	5	1qku_EST_B_600 PDB CREDO	0.503	0.313	0.503	0.010
Rv0260c.3	2	3qgz_ADN_A_127 PDB CREDO	0.542	0.255	0.503	0.010
Rv0260c.3	2	1xzx_T3_X_500 PDB CREDO	0.713	0.071	0.503	0.010
Rv0260c.3	2	3uvv_T3_A_501 PDB CREDO	0.712	0.072	0.502	0.011
Rv0260c.4	2	1sn5_T3_D_602 PDB CREDO	0.502	0.315	0.502	0.011
Rv0260c.4	2	1sn5_T3_C_601 PDB CREDO	0.572	0.215	0.502	0.011
Rv0260c.3	2	3ads_IMN_A_2 PDB CREDO	0.602	0.177	0.502	0.011
Rv0260c.3	5	1ere_EST_A_600 PDB CREDO	0.501	0.317	0.501	0.011
Rv0260c.3	5	1ere_EST_E_600 PDB CREDO	0.501	0.317	0.501	0.011
Rv0260c.3	2	3jwq_VIA_B_901 PDB CREDO	0.560	0.231	0.501	0.011
Rv0260c.4	2	3ads_IMN_B_3 PDB CREDO	0.546	0.249	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
uroporphyrinogen IIIPubChem	0.9	836.795
hydroxymethylbilanePubChem	0.9	854.81