SInCRe - Rv0242c

Tuberculist information

Gene name	fabG4
Protein function	Probable 3-oxoacyl-[acyl-carrier protein] reductase FabG4 (3-ketoacyl-acyl carrier protein reductase)
Functional category(tuberculist)	lipid metabolism
Gene location(kb)	290.665
Molecular mass(da)	46798.1
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 454

	  		  	1    VAPKRSSDLFSQVVNSGPGSFLARQLGVPQPETLRRYRAGEPPLTGSLLIGGAGRVVEPL   60
			  	61   RAALEKDYDLVGNNLGGRWADSFGGLVFDATGITEPAGLKGLHEFFTPVLRNLGRCGRVV  120
			  	121  VVGGTPEAAASTNERIAQRALEGFTRSLGKELRRGATTALVYLSPDAKPAATGLESTMRF  180
			  	181  LLSAKSAYVDGQVFSVGADDSTPPADWEKPLDGKVAIVTGAARGIGATIAEVFARDGAHV  240
			  	241  VAIDVESAAENLAETASKVGGTALWLDVTADDAVDKISEHLRDHHGGKADILVNNAGITR  300
			  	301  DKLLANMDDARWDAVLAVNLLAPLRLTEGLVGNGSIGEGGRVIGLSSIAGIAGNRGQTNY  360
			  	361  ATTKAGMIGITQALAPGLAAKGITINAVAPGFIETQMTAAIPLATREVGRRLNSLLQGGQ  420
			  	421  PVDVAEAIAYFASPASNAVTGNVIRVCGQAMIGA

Known structures in the PDB

	PDB ID	3M1L
	Total residue count	864
	Number of chains	2
	Method	X-RAY
	Resolution	2.52

	PDB ID	3Q6I
	Total residue count	1784
	Number of chains	4
	Method	X-RAY
	Resolution	2.59

	PDB ID	3V1T
	Total residue count	924
	Number of chains	2
	Method	X-RAY
	Resolution	1.88

	PDB ID	3V1U
	Total residue count	462
	Number of chains	1
	Method	X-RAY
	Resolution	2.5

	PDB ID	4FW8
	Total residue count	1816
	Number of chains	4
	Method	X-RAY
	Resolution	2.79

Number of amino acids : 454

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
adh_short	PF00106	214-379

Mtb Structural Proteome models

Model Number	1
Model name	Rv0242c
Template	1ULS APDB CREDO
Template coverage	3_242
Template Identity(%)	38.8
Model coverage(%)	53.5
Normalized DOPE score	-0.305

Model Number	2
Model name	Rv0242c.1
Template	2FR1 APDB CREDO
Template coverage	1459_1840
Template Identity(%)	23.1
Model coverage(%)	78.0
Normalized DOPE score	0.52

Structure Models from Chopin

Model Number	1
Profile	c.2.1.2 - 3.40.50.720 Click for model details
zscore	16.29
Residue begin	220
Residue end	448

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0242c	Gene name	Confidence Score
Rv0241c	htdX	0.997
Rv0241c	htdX	0.997
Rv0243	fadA2	0.954
Rv0243	fadA2	0.954
Rv2244	acpM	0.947
Rv2245	kasA	0.943
Rv2245	kasA	0.943
Rv2524c	fas	0.931
Rv2524c	fas	0.931
Rv2524c	fas	0.931
Rv2524c	fas	0.931
Rv2524c	fas	0.931
Rv2524c	fas	0.931
Rv2524c	fas	0.931
Rv2246	kasB	0.924
Rv2246	kasB	0.924
Rv0533c	fabH	0.921
Rv0533c	fabH	0.921
Rv0533c	fabH	0.921

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0242c.1	25	3erd_DES_B_800 PDB CREDO	0.767	0.039	0.660	0.001
Rv0242c.1	25	1ya4_CTX_B_2 PDB CREDO	0.682	0.095	0.656	0.001
Rv0242c.1	25	1ya4_CTX_C_3 PDB CREDO	0.676	0.100	0.650	0.001
Rv0242c.1	15	3spk_TPV_A_100 PDB CREDO	0.647	0.128	0.647	0.001
Rv0242c.1	9	1mx1_THA_B_2 PDB CREDO	0.671	0.105	0.644	0.001
Rv0242c.1	9	3ols_EST_A_600 PDB CREDO	0.698	0.083	0.642	0.001
Rv0242c.1	9	3ols_EST_B_600 PDB CREDO	0.697	0.083	0.642	0.001
Rv0242c.1	9	1g50_EST_A_600 PDB CREDO	0.696	0.084	0.641	0.001
Rv0242c.1	9	1mx1_THA_A_1 PDB CREDO	0.637	0.137	0.637	0.001
Rv0242c.1	9	2yja_EST_B_1550 PDB CREDO	0.691	0.087	0.637	0.001
Rv0242c.1	9	3uud_EST_A_600 PDB CREDO	0.691	0.088	0.636	0.001
Rv0242c.1	9	3uud_EST_B_600 PDB CREDO	0.690	0.089	0.635	0.001
Rv0242c.1	1	1udt_VIA_A_1000 PDB CREDO	0.660	0.115	0.630	0.001
Rv0242c.1	9	1mx1_THA_F_6 PDB CREDO	0.709	0.074	0.627	0.001
Rv0242c.1	25	2j7y_E3O_A_1454 PDB CREDO	0.652	0.123	0.627	0.001
Rv0242c.1	13	1jg3_ADN_A_500 PDB CREDO	0.627	0.148	0.627	0.001
Rv0242c.1	9	1mx1_THA_D_4 PDB CREDO	0.707	0.076	0.625	0.001
Rv0242c.1	9	3ads_IMN_B_3 PDB CREDO	0.649	0.125	0.622	0.001
Rv0242c.1	9	3adx_IMN_B_3 PDB CREDO	0.671	0.105	0.618	0.001
Rv0242c.1	25	1g50_EST_A_600 PDB CREDO	0.667	0.108	0.616	0.002
Rv0242c.1	25	3ols_EST_A_600 PDB CREDO	0.664	0.111	0.614	0.002
Rv0242c.1	25	3uud_EST_B_600 PDB CREDO	0.662	0.113	0.612	0.002
Rv0242c.1	9	1ya4_CTX_B_2 PDB CREDO	0.690	0.089	0.610	0.002
Rv0242c.1	25	2yja_EST_B_1550 PDB CREDO	0.660	0.114	0.610	0.002
Rv0242c.1	25	3uud_EST_A_600 PDB CREDO	0.660	0.114	0.610	0.002
Rv0242c.1	9	3lfa_1N1_A_361 PDB CREDO	0.610	0.167	0.610	0.002
Rv0242c.1	25	3ols_EST_B_600 PDB CREDO	0.660	0.115	0.609	0.002
Rv0242c.1	15	3e22_LOC_B_700 PDB CREDO	0.694	0.086	0.609	0.002
Rv0242c.1	15	1jg2_ADN_A_500 PDB CREDO	0.651	0.124	0.608	0.002
Rv0242c.1	15	3e22_LOC_D_700 PDB CREDO	0.692	0.087	0.607	0.002
Rv0242c.1	15	3bbt_FMM_D_91 PDB CREDO	0.627	0.148	0.606	0.002
Rv0242c.1	9	1pcg_EST_A_1 PDB CREDO	0.632	0.143	0.605	0.002
Rv0242c.1	9	3bbt_FMM_B_91 PDB CREDO	0.739	0.054	0.605	0.002
Rv0242c.1	9	1s9p_DES_B_459 PDB CREDO	0.684	0.094	0.605	0.002
Rv0242c.1	9	1s9p_DES_C_500 PDB CREDO	0.684	0.094	0.605	0.002
Rv0242c.1	9	1ya4_CTX_C_3 PDB CREDO	0.682	0.095	0.603	0.002
Rv0242c.1	15	2h77_T3_A_1 PDB CREDO	0.603	0.176	0.603	0.002
Rv0242c.1	9	1g50_EST_C_2600 PDB CREDO	0.628	0.147	0.602	0.002
Rv0242c.1	9	2ocf_EST_A_596 PDB CREDO	0.628	0.147	0.602	0.002
Rv0242c.1	25	1s9p_DES_D_600 PDB CREDO	0.724	0.064	0.602	0.002
Rv0242c.1	9	2j7x_EST_A_1454 PDB CREDO	0.627	0.148	0.601	0.002
Rv0242c.1	25	3lfa_1N1_A_361 PDB CREDO	0.707	0.076	0.601	0.002
Rv0242c.1	13	1ict_T44_D_129 PDB CREDO	0.700	0.081	0.601	0.002
Rv0242c.1	9	1a52_EST_B_2 PDB CREDO	0.626	0.149	0.600	0.002
Rv0242c.1	9	3oll_EST_B_600 PDB CREDO	0.626	0.149	0.600	0.002
Rv0242c.1	13	3f4x_KLT_A_300 PDB CREDO	0.645	0.129	0.599	0.002
Rv0242c.1	9	3oll_EST_A_600 PDB CREDO	0.624	0.151	0.598	0.002
Rv0242c.1	9	1a52_EST_A_1 PDB CREDO	0.623	0.152	0.598	0.002
Rv0242c.1	15	3ut5_LOC_D_502 PDB CREDO	0.680	0.097	0.597	0.002
Rv0242c.1	1	2ij7_TPF_F_2474 PDB CREDO	0.625	0.151	0.596	0.002
Rv0242c.1	9	1qkt_EST_A_600 PDB CREDO	0.622	0.154	0.596	0.002
Rv0242c.1	9	3hm1_J3Z_B_1 PDB CREDO	0.622	0.154	0.596	0.002
Rv0242c.1	9	1ere_EST_D_600 PDB CREDO	0.620	0.156	0.594	0.002
Rv0242c.1	13	1ie4_T44_B_328 PDB CREDO	0.664	0.111	0.593	0.002
Rv0242c.1	9	1ere_EST_C_600 PDB CREDO	0.619	0.157	0.593	0.002
Rv0242c.1	13	1jg2_ADN_A_500 PDB CREDO	0.660	0.115	0.593	0.002
Rv0242c.1	13	1jg3_ADN_B_550 PDB CREDO	0.664	0.111	0.593	0.002
Rv0242c.1	9	1ere_EST_F_600 PDB CREDO	0.618	0.158	0.592	0.002
Rv0242c.1	15	1hwi_115_A_2 PDB CREDO	0.612	0.165	0.592	0.002
Rv0242c.1	25	3erd_DES_A_600 PDB CREDO	0.686	0.092	0.591	0.002
Rv0242c.1	13	2xpv_MIY_A_1209 PDB CREDO	0.634	0.140	0.590	0.003
Rv0242c.1	25	1mx1_THA_E_5 PDB CREDO	0.661	0.114	0.590	0.003
Rv0242c.1	15	2h79_T3_A_1 PDB CREDO	0.610	0.168	0.590	0.003
Rv0242c.1	1	4enh_FVX_A_602 PDB CREDO	0.616	0.160	0.589	0.003
Rv0242c.1	1	1uho_VDN_A_1000 PDB CREDO	0.702	0.079	0.589	0.003
Rv0242c.1	15	3gws_T3_X_500 PDB CREDO	0.628	0.147	0.588	0.003
Rv0242c.1	9	1r9o_FLP_A_501 PDB CREDO	0.700	0.081	0.587	0.003
Rv0242c.1	15	1sa1_POD_B_700 PDB CREDO	0.752	0.047	0.584	0.003
Rv0242c.1	1	3b2r_VDN_B_1 PDB CREDO	0.611	0.166	0.584	0.003
Rv0242c.1	15	1sa1_POD_D_701 PDB CREDO	0.729	0.060	0.583	0.003
Rv0242c.1	13	3q1e_T44_C_128 PDB CREDO	0.628	0.147	0.583	0.003
Rv0242c.1	9	2fum_MIX_B_1539 PDB CREDO	0.632	0.143	0.582	0.003
Rv0242c.1	15	3oht_1N1_B_1000 PDB CREDO	0.645	0.130	0.581	0.003
Rv0242c.1	20	3a2q_ACA_A_601 PDB CREDO	0.652	0.122	0.581	0.003
Rv0242c.1	1	3b2r_VDN_A_1 PDB CREDO	0.608	0.170	0.581	0.003
Rv0242c.1	1	1udu_CIA_B_2003 PDB CREDO	0.662	0.113	0.579	0.003
Rv0242c.1	9	3sxr_1N1_B_2 PDB CREDO	0.629	0.147	0.579	0.003
Rv0242c.1	15	3ut5_LOC_B_502 PDB CREDO	0.701	0.080	0.578	0.003
Rv0242c.1	9	3kw2_ADN_B_300 PDB CREDO	0.653	0.121	0.578	0.003
Rv0242c.1	15	1bsx_T3_A_1 PDB CREDO	0.618	0.159	0.578	0.003
Rv0242c.1	15	1bsx_T3_B_2 PDB CREDO	0.618	0.159	0.578	0.003
Rv0242c.1	9	1pcg_EST_B_2 PDB CREDO	0.688	0.090	0.577	0.003
Rv0242c.1	1	1iol_EST_A_400 PDB CREDO	0.604	0.175	0.576	0.003
Rv0242c.1	15	1xzx_T3_X_500 PDB CREDO	0.635	0.140	0.576	0.003
Rv0242c.1	13	2ito_IRE_A_2020 PDB CREDO	0.619	0.157	0.574	0.003
Rv0242c.1	15	1hwi_115_D_3 PDB CREDO	0.654	0.120	0.574	0.003
Rv0242c.1	25	3bbt_FMM_B_91 PDB CREDO	0.597	0.183	0.574	0.003
Rv0242c.1	25	1a52_EST_B_2 PDB CREDO	0.704	0.078	0.574	0.003
Rv0242c.1	15	1hwi_115_B_1 PDB CREDO	0.653	0.121	0.573	0.003
Rv0242c.1	25	1g50_EST_C_2600 PDB CREDO	0.703	0.078	0.573	0.003
Rv0242c.1	15	3uvv_T3_A_501 PDB CREDO	0.632	0.143	0.573	0.003
Rv0242c.1	1	1udu_CIA_A_1003 PDB CREDO	0.630	0.145	0.573	0.003
Rv0242c.1	9	3g5d_1N1_A_1 PDB CREDO	0.673	0.103	0.572	0.003
Rv0242c.1	25	1a52_EST_A_1 PDB CREDO	0.702	0.079	0.572	0.003
Rv0242c.1	9	3sxr_1N1_A_1 PDB CREDO	0.646	0.128	0.572	0.003
Rv0242c.1	15	3qt0_486_A_4 PDB CREDO	0.591	0.189	0.572	0.003
Rv0242c.1	13	1ict_T44_C_128 PDB CREDO	0.722	0.065	0.572	0.003
Rv0242c.1	25	3hm1_J3Z_B_1 PDB CREDO	0.701	0.080	0.572	0.003
Rv0242c.1	9	2zva_1N1_A_513 PDB CREDO	0.645	0.129	0.571	0.004
Rv0242c.1	25	2j7x_EST_A_1454 PDB CREDO	0.700	0.081	0.571	0.004
Rv0242c.1	1	3jus_ECL_A_600 PDB CREDO	0.598	0.181	0.571	0.004
Rv0242c.1	25	1qkt_EST_A_600 PDB CREDO	0.699	0.081	0.570	0.004
Rv0242c.1	1	1xoz_CIA_A_501 PDB CREDO	0.570	0.217	0.570	0.004
Rv0242c.1	15	1jg3_ADN_A_500 PDB CREDO	0.679	0.098	0.569	0.004
Rv0242c.1	25	3oll_EST_B_600 PDB CREDO	0.698	0.082	0.569	0.004
Rv0242c.1	1	2jap_J01_B_1249 PDB CREDO	0.625	0.151	0.569	0.004
Rv0242c.1	9	2w8y_NDR_B_1000 PDB CREDO	0.643	0.132	0.569	0.004
Rv0242c.1	9	3g5d_1N1_B_1 PDB CREDO	0.668	0.107	0.569	0.004
Rv0242c.1	25	2ocf_EST_A_596 PDB CREDO	0.698	0.083	0.569	0.004
Rv0242c.1	25	3oll_EST_A_600 PDB CREDO	0.698	0.083	0.569	0.004
Rv0242c.1	9	3hm1_J3Z_A_2 PDB CREDO	0.678	0.099	0.568	0.004
Rv0242c.1	13	3ut5_LOC_D_502 PDB CREDO	0.771	0.037	0.568	0.004
Rv0242c.1	25	1ere_EST_F_600 PDB CREDO	0.697	0.083	0.568	0.004
Rv0242c.1	1	2jap_J01_A_1249 PDB CREDO	0.624	0.152	0.568	0.004
Rv0242c.1	9	2uxo_TAC_B_1211 PDB CREDO	0.616	0.160	0.567	0.004
Rv0242c.1	25	1ere_EST_D_600 PDB CREDO	0.696	0.084	0.567	0.004
Rv0242c.1	25	1s9p_DES_B_459 PDB CREDO	0.589	0.192	0.566	0.004
Rv0242c.1	25	1pcg_EST_A_1 PDB CREDO	0.694	0.086	0.566	0.004
Rv0242c.1	9	1g50_EST_B_1600 PDB CREDO	0.674	0.102	0.566	0.004
Rv0242c.1	9	1qku_EST_A_600 PDB CREDO	0.674	0.102	0.566	0.004
Rv0242c.1	1	2ij7_TPF_B_2470 PDB CREDO	0.621	0.154	0.566	0.004
Rv0242c.1	1	2jap_J01_D_1249 PDB CREDO	0.621	0.154	0.566	0.004
Rv0242c.1	1	3axz_ADN_A_401 PDB CREDO	0.618	0.158	0.565	0.004
Rv0242c.1	25	1ere_EST_C_600 PDB CREDO	0.693	0.086	0.565	0.004
Rv0242c.1	25	1s9p_DES_C_500 PDB CREDO	0.587	0.195	0.564	0.004
Rv0242c.1	13	1hwi_115_A_2 PDB CREDO	0.695	0.085	0.564	0.004
Rv0242c.1	15	1zgy_BRL_A_503 PDB CREDO	0.564	0.225	0.564	0.004
Rv0242c.1	9	1qku_EST_B_600 PDB CREDO	0.672	0.104	0.564	0.004
Rv0242c.1	1	1fdu_EST_A_351 PDB CREDO	0.590	0.191	0.563	0.004
Rv0242c.1	1	2bxf_DZP_B_2001 PDB CREDO	0.563	0.226	0.563	0.004
Rv0242c.1	25	1mx1_THA_F_6 PDB CREDO	0.586	0.196	0.563	0.004
Rv0242c.1	9	1ere_EST_E_600 PDB CREDO	0.671	0.105	0.563	0.004
Rv0242c.1	9	1gwr_EST_A_600 PDB CREDO	0.671	0.105	0.563	0.004
Rv0242c.1	9	1qku_EST_C_600 PDB CREDO	0.671	0.105	0.563	0.004
Rv0242c.1	15	2xpv_MIY_A_1209 PDB CREDO	0.624	0.151	0.563	0.004
Rv0242c.1	1	2bxf_DZP_A_2001 PDB CREDO	0.562	0.227	0.562	0.004
Rv0242c.1	1	2jap_J01_C_1249 PDB CREDO	0.618	0.158	0.562	0.004
Rv0242c.1	1	2ij7_TPF_A_2472 PDB CREDO	0.617	0.160	0.561	0.004
Rv0242c.1	1	2ij7_TPF_D_2473 PDB CREDO	0.617	0.160	0.561	0.004
Rv0242c.1	13	2vke_TAC_A_222 PDB CREDO	0.628	0.147	0.561	0.004
Rv0242c.1	9	1ere_EST_B_600 PDB CREDO	0.668	0.107	0.560	0.004
Rv0242c.1	1	1z9h_IMN_B_381 PDB CREDO	0.640	0.135	0.560	0.004
Rv0242c.1	9	1mx1_THA_E_5 PDB CREDO	0.737	0.056	0.560	0.004
Rv0242c.1	13	3ri5_IVM_A_349 PDB CREDO	0.603	0.175	0.560	0.004
Rv0242c.1	9	3qlg_1N1_B_601 PDB CREDO	0.658	0.117	0.560	0.004
Rv0242c.1	13	2xpw_OTC_A_222 PDB CREDO	0.626	0.149	0.559	0.004
Rv0242c.1	13	3rif_IVM_E_402 PDB CREDO	0.602	0.176	0.559	0.004
Rv0242c.1	1	1z9h_IMN_D_476 PDB CREDO	0.638	0.136	0.559	0.004
Rv0242c.1	13	1hwi_115_C_4 PDB CREDO	0.622	0.154	0.558	0.004
Rv0242c.1	9	1ere_EST_A_600 PDB CREDO	0.665	0.110	0.558	0.004
Rv0242c.1	9	1gwr_EST_B_600 PDB CREDO	0.665	0.110	0.558	0.004
Rv0242c.1	9	3qlg_1N1_A_601 PDB CREDO	0.655	0.119	0.557	0.004
Rv0242c.1	25	1mx1_THA_B_2 PDB CREDO	0.628	0.147	0.557	0.004
Rv0242c.1	1	3mdv_CL6_A_506 PDB CREDO	0.557	0.234	0.557	0.004
Rv0242c.1	13	3rhw_IVM_A_348 PDB CREDO	0.600	0.179	0.557	0.004
Rv0242c.1	13	3ria_IVM_E_349 PDB CREDO	0.600	0.179	0.557	0.004
Rv0242c.1	25	1mx1_THA_D_4 PDB CREDO	0.579	0.205	0.557	0.004
Rv0242c.1	9	1s9p_DES_A_459 PDB CREDO	0.787	0.030	0.556	0.005
Rv0242c.1	13	3ri5_IVM_B_349 PDB CREDO	0.599	0.180	0.556	0.005
Rv0242c.1	13	3ri5_IVM_D_349 PDB CREDO	0.599	0.180	0.556	0.005
Rv0242c.1	1	1z9h_IMN_A_379 PDB CREDO	0.635	0.139	0.556	0.005
Rv0242c.1	1	1z9h_IMN_C_379 PDB CREDO	0.635	0.139	0.556	0.005
Rv0242c.1	13	3oht_1N1_A_1000 PDB CREDO	0.577	0.208	0.556	0.005
Rv0242c.1	13	3rif_IVM_A_403 PDB CREDO	0.575	0.210	0.555	0.005
Rv0242c.1	13	3rhw_IVM_B_348 PDB CREDO	0.597	0.183	0.554	0.005
Rv0242c.1	13	3rhw_IVM_D_348 PDB CREDO	0.596	0.184	0.553	0.005
Rv0242c.1	13	3rhw_IVM_D_349 PDB CREDO	0.595	0.185	0.552	0.005
Rv0242c.1	13	3ria_IVM_A_348 PDB CREDO	0.595	0.185	0.552	0.005
Rv0242c.1	13	3ria_IVM_C_350 PDB CREDO	0.595	0.185	0.552	0.005
Rv0242c.1	13	3rif_IVM_B_403 PDB CREDO	0.572	0.214	0.552	0.005
Rv0242c.1	13	3rif_IVM_D_402 PDB CREDO	0.572	0.214	0.552	0.005
Rv0242c.1	25	1s9p_DES_A_459 PDB CREDO	0.664	0.111	0.551	0.005
Rv0242c.1	25	1dtl_BEP_A_204 PDB CREDO	0.597	0.183	0.551	0.005
Rv0242c.1	13	3ria_IVM_E_348 PDB CREDO	0.594	0.187	0.551	0.005
Rv0242c.1	1	3tbg_RTZ_A_2 PDB CREDO	0.605	0.173	0.551	0.005
Rv0242c.1	1	1fds_EST_A_350 PDB CREDO	0.629	0.146	0.550	0.005
Rv0242c.1	1	2iyf_ERY_B_1399 PDB CREDO	0.629	0.146	0.550	0.005
Rv0242c.1	13	3rhw_IVM_B_349 PDB CREDO	0.593	0.188	0.550	0.005
Rv0242c.1	13	3ri5_IVM_C_350 PDB CREDO	0.570	0.217	0.549	0.005
Rv0242c.1	13	3rif_IVM_A_402 PDB CREDO	0.570	0.217	0.549	0.005
Rv0242c.1	9	1m17_AQ4_A_999 PDB CREDO	0.573	0.213	0.549	0.005
Rv0242c.1	9	3oht_1N1_A_1000 PDB CREDO	0.697	0.083	0.549	0.005
Rv0242c.1	15	2xkw_P1B_B_1475 PDB CREDO	0.631	0.144	0.549	0.005
Rv0242c.1	13	2xn5_FUN_A_1356 PDB CREDO	0.665	0.110	0.549	0.005
Rv0242c.1	1	4cox_IMN_D_701 PDB CREDO	0.549	0.246	0.549	0.005
Rv0242c.1	15	1hwk_117_D_3 PDB CREDO	0.664	0.111	0.548	0.005
Rv0242c.1	15	1hwl_FBI_B_1 PDB CREDO	0.684	0.094	0.547	0.005
Rv0242c.1	15	2y6o_1N1_A_1892 PDB CREDO	0.603	0.175	0.547	0.005
Rv0242c.1	1	1kvl_CLS_A_371 PDB CREDO	0.572	0.214	0.546	0.005
Rv0242c.1	3	3s23_CER_A_359 PDB CREDO	0.546	0.249	0.546	0.005
Rv0242c.1	15	1hwl_FBI_D_3 PDB CREDO	0.682	0.095	0.546	0.005
Rv0242c.1	9	1sn5_T3_C_601 PDB CREDO	0.545	0.251	0.545	0.005
Rv0242c.1	13	3ria_IVM_C_349 PDB CREDO	0.565	0.223	0.545	0.005
Rv0242c.1	1	2bdm_TMI_A_502 PDB CREDO	0.628	0.147	0.544	0.005
Rv0242c.1	13	2ity_IRE_A_2020 PDB CREDO	0.634	0.141	0.544	0.006
Rv0242c.1	9	1uay_ADN_A_1001 PDB CREDO	0.648	0.126	0.543	0.006
Rv0242c.1	13	2trt_TAC_A_222 PDB CREDO	0.659	0.116	0.543	0.006
Rv0242c.1	2	2w03_ADN_A_1588 PDB CREDO	0.543	0.253	0.543	0.006
Rv0242c.1	15	3jwq_VIA_D_901 PDB CREDO	0.562	0.228	0.543	0.006
Rv0242c.1	9	1mrl_DOL_A_300 PDB CREDO	0.543	0.254	0.543	0.006
Rv0242c.1	1	1jip_KTN_A_801 PDB CREDO	0.674	0.102	0.543	0.006
Rv0242c.1	9	2fum_MIX_C_2539 PDB CREDO	0.613	0.164	0.542	0.006
Rv0242c.1	15	3oht_1N1_A_1000 PDB CREDO	0.670	0.106	0.542	0.006
Rv0242c.1	9	3b2r_VDN_A_1 PDB CREDO	0.617	0.159	0.542	0.006
Rv0242c.1	15	2a69_RPT_M_8002 PDB CREDO	0.541	0.256	0.541	0.006
Rv0242c.1	1	1eqg_IBP_B_1701 PDB CREDO	0.541	0.256	0.541	0.006
Rv0242c.1	1	3tvx_PNX_A_902 PDB CREDO	0.624	0.151	0.541	0.006
Rv0242c.1	20	3r9c_ECL_A_451 PDB CREDO	0.637	0.138	0.541	0.006
Rv0242c.1	9	2uxp_CLM_A_1211 PDB CREDO	0.645	0.130	0.541	0.006
Rv0242c.1	9	2uxp_CLM_B_1211 PDB CREDO	0.645	0.130	0.541	0.006
Rv0242c.1	9	3b2r_VDN_B_1 PDB CREDO	0.616	0.160	0.541	0.006
Rv0242c.1	9	1mx1_THA_C_3 PDB CREDO	0.765	0.040	0.541	0.006
Rv0242c.1	13	1hwi_115_D_3 PDB CREDO	0.734	0.057	0.541	0.006
Rv0242c.1	9	3erd_DES_A_600 PDB CREDO	0.738	0.055	0.540	0.006
Rv0242c.1	1	1eqg_IBP_A_701 PDB CREDO	0.540	0.258	0.540	0.006
Rv0242c.1	1	3mdt_VOR_B_506 PDB CREDO	0.727	0.062	0.540	0.006
Rv0242c.1	1	3n8y_DIF_A_701 PDB CREDO	0.540	0.258	0.540	0.006
Rv0242c.1	9	1jg3_ADN_B_550 PDB CREDO	0.635	0.140	0.540	0.006
Rv0242c.1	13	1hwi_115_B_1 PDB CREDO	0.733	0.058	0.540	0.006
Rv0242c.1	9	3erd_DES_B_800 PDB CREDO	0.737	0.056	0.540	0.006
Rv0242c.1	15	1hwl_FBI_A_2 PDB CREDO	0.674	0.102	0.540	0.006
Rv0242c.1	13	3ut5_LOC_B_502 PDB CREDO	0.779	0.033	0.539	0.006
Rv0242c.1	25	1mx1_THA_C_3 PDB CREDO	0.649	0.126	0.539	0.006
Rv0242c.1	13	2o7o_DXT_A_222 PDB CREDO	0.653	0.121	0.539	0.006
Rv0242c.1	13	3e22_LOC_D_700 PDB CREDO	0.731	0.059	0.538	0.006
Rv0242c.1	1	1xot_VDN_B_102 PDB CREDO	0.538	0.261	0.538	0.006
Rv0242c.1	1	3pgh_FLP_B_701 PDB CREDO	0.538	0.261	0.538	0.006
Rv0242c.1	15	1hwk_117_B_1 PDB CREDO	0.734	0.057	0.538	0.006
Rv0242c.1	15	1hwl_FBI_C_4 PDB CREDO	0.672	0.104	0.538	0.006
Rv0242c.1	13	3e22_LOC_B_700 PDB CREDO	0.730	0.060	0.538	0.006
Rv0242c.1	1	1xos_VIA_A_1 PDB CREDO	0.614	0.162	0.537	0.006
Rv0242c.1	9	1xbb_STI_A_1 PDB CREDO	0.739	0.054	0.537	0.006
Rv0242c.1	9	3vkx_T3_A_301 PDB CREDO	0.704	0.078	0.537	0.006
Rv0242c.1	15	3frq_ERY_B_195 PDB CREDO	0.612	0.165	0.537	0.006
Rv0242c.1	1	3aob_RFP_C_2002 PDB CREDO	0.537	0.262	0.537	0.006
Rv0242c.1	13	3ri5_IVM_E_349 PDB CREDO	0.625	0.150	0.537	0.006
Rv0242c.1	1	4dx7_DM2_A_1106 PDB CREDO	0.561	0.228	0.536	0.006
Rv0242c.1	9	1xp0_VDN_A_201 PDB CREDO	0.560	0.231	0.536	0.006
Rv0242c.1	1	3nrr_D16_A_520 PDB CREDO	0.587	0.195	0.536	0.006
Rv0242c.1	25	2zva_1N1_A_513 PDB CREDO	0.557	0.234	0.535	0.006
Rv0242c.1	1	3mdt_VOR_A_506 PDB CREDO	0.720	0.067	0.535	0.006
Rv0242c.1	9	3bbt_FMM_D_91 PDB CREDO	0.811	0.021	0.535	0.006
Rv0242c.1	1	1xot_VDN_A_101 PDB CREDO	0.611	0.166	0.535	0.006
Rv0242c.1	1	1xp0_VDN_A_201 PDB CREDO	0.611	0.166	0.535	0.006
Rv0242c.1	13	1ie4_T44_A_128 PDB CREDO	0.675	0.101	0.535	0.006
Rv0242c.1	15	1hwi_115_C_4 PDB CREDO	0.572	0.214	0.534	0.006
Rv0242c.1	13	1oq5_CEL_A_701 PDB CREDO	0.554	0.238	0.534	0.006
Rv0242c.1	15	1hwk_117_C_4 PDB CREDO	0.688	0.091	0.534	0.006
Rv0242c.1	15	1s9p_DES_A_459 PDB CREDO	0.592	0.189	0.534	0.006
Rv0242c.1	2	2x0p_ADN_A_1607 PDB CREDO	0.595	0.185	0.533	0.007
Rv0242c.1	15	1hwk_117_A_2 PDB CREDO	0.686	0.091	0.533	0.007
Rv0242c.1	1	1pbc_BHA_A_396 PDB CREDO	0.558	0.233	0.533	0.007
Rv0242c.1	1	3vrj_1KX_A_301 PDB CREDO	0.584	0.199	0.533	0.007
Rv0242c.1	13	2a69_RPT_C_8001 PDB CREDO	0.553	0.239	0.533	0.007
Rv0242c.1	13	3ce6_ADN_B_500 PDB CREDO	0.553	0.239	0.533	0.007
Rv0242c.1	13	3n58_ADN_D_500 PDB CREDO	0.553	0.239	0.533	0.007
Rv0242c.1	1	3pgh_FLP_A_701 PDB CREDO	0.533	0.269	0.533	0.007
Rv0242c.1	9	3oht_1N1_B_1000 PDB CREDO	0.754	0.046	0.533	0.007
Rv0242c.1	25	3oht_1N1_B_1000 PDB CREDO	0.641	0.133	0.533	0.007
Rv0242c.1	25	3ads_IMN_B_3 PDB CREDO	0.653	0.121	0.532	0.007
Rv0242c.1	13	2itz_IRE_A_2021 PDB CREDO	0.645	0.129	0.532	0.007
Rv0242c.1	13	3oht_1N1_B_1000 PDB CREDO	0.571	0.215	0.531	0.007
Rv0242c.1	25	3bbt_FMM_D_91 PDB CREDO	0.686	0.092	0.531	0.007
Rv0242c.1	1	3hbb_TMQ_D_614 PDB CREDO	0.556	0.236	0.531	0.007
Rv0242c.1	1	3tbg_RTZ_C_2 PDB CREDO	0.583	0.200	0.531	0.007
Rv0242c.1	13	3ce6_ADN_A_500 PDB CREDO	0.551	0.243	0.531	0.007
Rv0242c.1	9	1s9p_DES_D_600 PDB CREDO	0.749	0.048	0.529	0.007
Rv0242c.1	25	3adx_IMN_B_3 PDB CREDO	0.573	0.213	0.529	0.007
Rv0242c.1	9	1sn0_T44_C_601 PDB CREDO	0.603	0.175	0.529	0.007
Rv0242c.1	9	2bxf_DZP_B_2001 PDB CREDO	0.631	0.144	0.529	0.007
Rv0242c.1	13	2xkw_P1B_B_1475 PDB CREDO	0.549	0.246	0.529	0.007
Rv0242c.1	13	3ce6_ADN_C_500 PDB CREDO	0.548	0.247	0.528	0.007
Rv0242c.1	13	3n58_ADN_A_500 PDB CREDO	0.567	0.221	0.528	0.007
Rv0242c.1	1	2bxe_1FL_B_2001 PDB CREDO	0.580	0.204	0.527	0.007
Rv0242c.1	13	2xn6_T44_A_1370 PDB CREDO	0.639	0.135	0.527	0.007
Rv0242c.1	13	3ce6_ADN_D_500 PDB CREDO	0.547	0.248	0.527	0.007
Rv0242c.1	15	1jg3_ADN_B_550 PDB CREDO	0.704	0.078	0.527	0.007
Rv0242c.1	9	3tmz_06X_A_503 PDB CREDO	0.549	0.245	0.527	0.007
Rv0242c.1	13	2xn7_T44_A_1355 PDB CREDO	0.638	0.137	0.526	0.007
Rv0242c.1	1	3clb_TMQ_D_614 PDB CREDO	0.550	0.243	0.525	0.007
Rv0242c.1	15	1y0x_T44_X_500 PDB CREDO	0.636	0.138	0.525	0.007
Rv0242c.1	15	1ie4_T44_B_328 PDB CREDO	0.701	0.080	0.525	0.007
Rv0242c.1	15	3spk_TPV_B_100 PDB CREDO	0.695	0.084	0.525	0.007
Rv0242c.1	1	3u9f_CLM_B_221 PDB CREDO	0.574	0.212	0.525	0.007
Rv0242c.1	1	3u9f_CLM_F_221 PDB CREDO	0.574	0.212	0.525	0.007
Rv0242c.1	13	3g1u_ADN_A_438 PDB CREDO	0.611	0.166	0.525	0.007
Rv0242c.1	1	2bxe_1FL_A_2001 PDB CREDO	0.576	0.209	0.524	0.008
Rv0242c.1	13	3spk_TPV_A_100 PDB CREDO	0.624	0.151	0.524	0.008
Rv0242c.1	1	1fdu_EST_B_354 PDB CREDO	0.573	0.213	0.524	0.008
Rv0242c.1	13	3q1e_T44_D_328 PDB CREDO	0.719	0.067	0.523	0.008
Rv0242c.1	15	1fm6_BRL_D_503 PDB CREDO	0.580	0.204	0.523	0.008
Rv0242c.1	15	3bbt_FMM_B_91 PDB CREDO	0.672	0.104	0.523	0.008
Rv0242c.1	25	2jfa_RAL_B_600 PDB CREDO	0.820	0.018	0.523	0.008
Rv0242c.1	9	2j7y_E3O_A_1454 PDB CREDO	0.638	0.136	0.522	0.008
Rv0242c.1	9	2itz_IRE_A_2021 PDB CREDO	0.567	0.220	0.522	0.008
Rv0242c.1	2	3ik6_HCZ_B_262 PDB CREDO	0.550	0.243	0.522	0.008
Rv0242c.1	20	3ozk_T44_A_128 PDB CREDO	0.522	0.284	0.522	0.008
Rv0242c.1	25	3oht_1N1_A_1000 PDB CREDO	0.563	0.226	0.522	0.008
Rv0242c.1	13	3bbt_FMM_D_91 PDB CREDO	0.601	0.177	0.522	0.008
Rv0242c.1	15	3rif_IVM_A_403 PDB CREDO	0.599	0.180	0.521	0.008
Rv0242c.1	13	1ynn_RFP_C_1120 PDB CREDO	0.541	0.257	0.521	0.008
Rv0242c.1	9	3clb_TMQ_B_612 PDB CREDO	0.622	0.154	0.521	0.008
Rv0242c.1	13	3g1u_ADN_C_438 PDB CREDO	0.541	0.257	0.521	0.008
Rv0242c.1	9	1dtl_BEP_A_204 PDB CREDO	0.566	0.223	0.521	0.008
Rv0242c.1	1	3n0h_TOP_A_187 PDB CREDO	0.570	0.217	0.521	0.008
Rv0242c.1	9	1ie4_T44_A_128 PDB CREDO	0.543	0.254	0.520	0.008
Rv0242c.1	3	2wd9_IBP_A_1570 PDB CREDO	0.520	0.287	0.520	0.008
Rv0242c.1	1	2ij7_TPF_C_2471 PDB CREDO	0.664	0.111	0.520	0.008
Rv0242c.1	1	3iak_EV1_A_415 PDB CREDO	0.520	0.287	0.520	0.008
Rv0242c.1	13	3r9c_ECL_A_452 PDB CREDO	0.684	0.093	0.520	0.008
Rv0242c.1	25	1err_RAL_B_600 PDB CREDO	0.815	0.019	0.520	0.008
Rv0242c.1	25	1err_RAL_A_600 PDB CREDO	0.814	0.020	0.519	0.008
Rv0242c.1	15	3ln1_CEL_D_682 PDB CREDO	0.537	0.262	0.519	0.008
Rv0242c.1	9	1jg3_ADN_A_500 PDB CREDO	0.684	0.094	0.519	0.008
Rv0242c.1	13	3g1u_ADN_B_438 PDB CREDO	0.605	0.173	0.519	0.008
Rv0242c.1	1	3s7s_EXM_A_601 PDB CREDO	0.544	0.253	0.519	0.008
Rv0242c.1	1	3ua5_06X_A_501 PDB CREDO	0.599	0.180	0.519	0.008
Rv0242c.1	25	3ogp_017_A_200 PDB CREDO	0.865	0.008	0.519	0.008
Rv0242c.1	9	2bxf_DZP_A_2001 PDB CREDO	0.618	0.158	0.519	0.008
Rv0242c.1	25	2jfa_RAL_A_600 PDB CREDO	0.788	0.029	0.518	0.008
Rv0242c.1	25	3g5d_1N1_A_1 PDB CREDO	0.518	0.290	0.518	0.008
Rv0242c.1	25	3g5d_1N1_B_1 PDB CREDO	0.518	0.290	0.518	0.008
Rv0242c.1	15	3ri5_IVM_C_350 PDB CREDO	0.595	0.184	0.518	0.008
Rv0242c.1	1	2w9h_TOP_A_1160 PDB CREDO	0.518	0.291	0.518	0.008
Rv0242c.1	15	1cil_ETS_A_263 PDB CREDO	0.535	0.265	0.518	0.008
Rv0242c.1	9	3k54_1N1_A_1 PDB CREDO	0.681	0.096	0.517	0.008
Rv0242c.1	13	3cs8_BRL_A_503 PDB CREDO	0.602	0.176	0.517	0.008
Rv0242c.1	1	1pxx_DIF_C_2701 PDB CREDO	0.591	0.190	0.517	0.008
Rv0242c.1	13	1sa1_POD_D_701 PDB CREDO	0.769	0.038	0.517	0.008
Rv0242c.1	9	3tbg_RTZ_A_1 PDB CREDO	0.516	0.294	0.516	0.009
Rv0242c.1	25	3qlg_1N1_B_601 PDB CREDO	0.516	0.294	0.516	0.009
Rv0242c.1	13	3bl1_BL1_A_300 PDB CREDO	0.556	0.236	0.516	0.009
Rv0242c.1	13	3g1u_ADN_D_438 PDB CREDO	0.556	0.236	0.516	0.009
Rv0242c.1	15	1ya3_STR_B_2001 PDB CREDO	0.552	0.241	0.516	0.009
Rv0242c.1	15	3cs8_BRL_A_503 PDB CREDO	0.716	0.069	0.516	0.009
Rv0242c.1	25	2o4n_TPV_A_300 PDB CREDO	0.834	0.014	0.516	0.009
Rv0242c.1	15	2fum_MIX_D_3539 PDB CREDO	0.533	0.268	0.515	0.009
Rv0242c.1	15	3ria_IVM_C_349 PDB CREDO	0.592	0.188	0.515	0.009
Rv0242c.1	15	3rif_IVM_D_402 PDB CREDO	0.592	0.188	0.515	0.009
Rv0242c.1	9	3clb_TMQ_A_611 PDB CREDO	0.561	0.228	0.515	0.009
Rv0242c.1	15	3rif_IVM_A_402 PDB CREDO	0.592	0.189	0.515	0.009
Rv0242c.1	1	1cqe_FLP_B_2650 PDB CREDO	0.588	0.194	0.514	0.009
Rv0242c.1	1	2bxg_IBP_B_2001 PDB CREDO	0.588	0.194	0.514	0.009
Rv0242c.1	1	3tmz_06X_A_503 PDB CREDO	0.588	0.194	0.514	0.009
Rv0242c.1	9	2fum_MIX_A_539 PDB CREDO	0.702	0.079	0.514	0.009
Rv0242c.1	15	3f4x_KLT_A_300 PDB CREDO	0.660	0.114	0.514	0.009
Rv0242c.1	15	3q1e_T44_C_128 PDB CREDO	0.660	0.114	0.514	0.009
Rv0242c.1	2	3ik6_HCZ_B_800 PDB CREDO	0.570	0.216	0.514	0.009
Rv0242c.1	13	1zgf_TRU_A_300 PDB CREDO	0.554	0.239	0.514	0.009
Rv0242c.1	1	1tbf_VIA_A_501 PDB CREDO	0.514	0.297	0.514	0.009
Rv0242c.1	1	2x7h_PFN_A_1372 PDB CREDO	0.538	0.261	0.514	0.009
Rv0242c.1	1	3f8w_ADN_B_301 PDB CREDO	0.514	0.297	0.514	0.009
Rv0242c.1	15	3rif_IVM_B_403 PDB CREDO	0.590	0.191	0.514	0.009
Rv0242c.1	20	3o0q_ADN_A_1004 PDB CREDO	0.543	0.254	0.514	0.009
Rv0242c.1	20	3o0q_ADN_B_1004 PDB CREDO	0.543	0.254	0.514	0.009
Rv0242c.1	1	1pxx_DIF_A_701 PDB CREDO	0.587	0.195	0.513	0.009
Rv0242c.1	1	1pxx_DIF_D_3701 PDB CREDO	0.587	0.195	0.513	0.009
Rv0242c.1	9	3ug2_IRE_A_1 PDB CREDO	0.706	0.076	0.513	0.009
Rv0242c.1	15	2ito_IRE_A_2020 PDB CREDO	0.659	0.116	0.513	0.009
Rv0242c.1	13	3jwq_VIA_B_901 PDB CREDO	0.532	0.270	0.513	0.009
Rv0242c.1	9	3ri5_IVM_E_349 PDB CREDO	0.580	0.204	0.513	0.009
Rv0242c.1	1	3a3y_OBN_A_6000 PDB CREDO	0.513	0.299	0.513	0.009
Rv0242c.1	1	1pxx_DIF_B_1701 PDB CREDO	0.586	0.197	0.512	0.009
Rv0242c.1	13	3bbt_FMM_B_91 PDB CREDO	0.552	0.241	0.512	0.009
Rv0242c.1	9	3hbb_TMQ_C_613 PDB CREDO	0.558	0.232	0.512	0.009
Rv0242c.1	25	1d4y_TPV_A_501 PDB CREDO	0.829	0.015	0.512	0.009
Rv0242c.1	9	3ri5_IVM_B_349 PDB CREDO	0.626	0.149	0.512	0.009
Rv0242c.1	9	2ity_IRE_A_2020 PDB CREDO	0.579	0.205	0.512	0.009
Rv0242c.1	2	3o0q_ADN_B_1004 PDB CREDO	0.541	0.257	0.512	0.009
Rv0242c.1	15	1fm6_BRL_X_504 PDB CREDO	0.565	0.223	0.512	0.009
Rv0242c.1	1	1cqe_FLP_A_1650 PDB CREDO	0.585	0.198	0.512	0.009
Rv0242c.1	13	3sxr_1N1_A_1 PDB CREDO	0.595	0.185	0.511	0.009
Rv0242c.1	13	1hwk_117_D_3 PDB CREDO	0.738	0.055	0.511	0.009
Rv0242c.1	3	3s21_CER_A_359 PDB CREDO	0.613	0.164	0.511	0.009
Rv0242c.1	15	3h0a_9RA_A_500 PDB CREDO	0.528	0.275	0.511	0.009
Rv0242c.1	13	1d4f_ADN_C_603 PDB CREDO	0.549	0.246	0.511	0.009
Rv0242c.1	1	1eqh_FLP_A_701 PDB CREDO	0.584	0.199	0.511	0.009
Rv0242c.1	1	1eqh_FLP_B_1701 PDB CREDO	0.584	0.199	0.511	0.009
Rv0242c.1	1	3clb_TMQ_B_612 PDB CREDO	0.511	0.302	0.511	0.009
Rv0242c.1	1	3f8w_ADN_C_302 PDB CREDO	0.511	0.302	0.511	0.009
Rv0242c.1	13	1sa1_POD_B_700 PDB CREDO	0.782	0.032	0.510	0.009
Rv0242c.1	25	3qlg_1N1_A_601 PDB CREDO	0.510	0.303	0.510	0.009
Rv0242c.1	9	1fj8_CER_D_500 PDB CREDO	0.510	0.303	0.510	0.009
Rv0242c.1	15	2prg_BRL_A_1 PDB CREDO	0.565	0.223	0.510	0.009
Rv0242c.1	1	3hbb_TMQ_A_611 PDB CREDO	0.534	0.267	0.510	0.009
Rv0242c.1	9	2ito_IRE_A_2020 PDB CREDO	0.622	0.153	0.509	0.009
Rv0242c.1	13	1hwl_FBI_D_3 PDB CREDO	0.758	0.043	0.509	0.009
Rv0242c.1	13	2pou_I7A_A_1000 PDB CREDO	0.549	0.246	0.509	0.009
Rv0242c.1	1	3pgh_FLP_D_701 PDB CREDO	0.581	0.202	0.509	0.010
Rv0242c.1	9	3rhw_IVM_B_348 PDB CREDO	0.621	0.154	0.509	0.010
Rv0242c.1	9	2gqg_1N1_A_501 PDB CREDO	0.694	0.085	0.508	0.010
Rv0242c.1	13	1hwl_FBI_B_1 PDB CREDO	0.757	0.044	0.508	0.010
Rv0242c.1	9	3rhw_IVM_B_349 PDB CREDO	0.621	0.155	0.508	0.010
Rv0242c.1	9	3ri5_IVM_A_349 PDB CREDO	0.621	0.155	0.508	0.010
Rv0242c.1	9	3ri5_IVM_D_349 PDB CREDO	0.621	0.155	0.508	0.010
Rv0242c.1	9	3ria_IVM_A_348 PDB CREDO	0.621	0.155	0.508	0.010
Rv0242c.1	2	3o0q_ADN_A_1004 PDB CREDO	0.536	0.264	0.508	0.010
Rv0242c.1	9	3rhw_IVM_D_348 PDB CREDO	0.620	0.156	0.507	0.010
Rv0242c.1	9	3rif_IVM_E_402 PDB CREDO	0.620	0.156	0.507	0.010
Rv0242c.1	9	3ri5_IVM_C_350 PDB CREDO	0.692	0.087	0.507	0.010
Rv0242c.1	25	1qkn_RAL_A_600 PDB CREDO	0.723	0.064	0.507	0.010
Rv0242c.1	9	1fj8_CER_B_500 PDB CREDO	0.507	0.307	0.507	0.010
Rv0242c.1	9	2nnj_225_A_501 PDB CREDO	0.698	0.083	0.507	0.010
Rv0242c.1	9	3hbb_TMQ_A_611 PDB CREDO	0.633	0.141	0.507	0.010
Rv0242c.1	9	3pgh_FLP_D_701 PDB CREDO	0.529	0.274	0.507	0.010
Rv0242c.1	1	4cox_IMN_A_701 PDB CREDO	0.579	0.205	0.507	0.010
Rv0242c.1	15	1uwh_BAX_A_1723 PDB CREDO	0.614	0.162	0.507	0.010
Rv0242c.1	15	3tkd_CYZ_B_267 PDB CREDO	0.614	0.162	0.507	0.010
Rv0242c.1	15	2aax_PDN_A_502 PDB CREDO	0.524	0.282	0.507	0.010
Rv0242c.1	9	3rhw_IVM_D_349 PDB CREDO	0.619	0.157	0.507	0.010
Rv0242c.1	13	1fr6_AZR_A_362 PDB CREDO	0.546	0.250	0.506	0.010
Rv0242c.1	13	1z9y_FUN_A_500 PDB CREDO	0.546	0.250	0.506	0.010
Rv0242c.1	1	3f8w_ADN_A_300 PDB CREDO	0.506	0.309	0.506	0.010
Rv0242c.1	9	2fum_MIX_D_3539 PDB CREDO	0.768	0.038	0.506	0.010
Rv0242c.1	15	2aa6_STR_A_401 PDB CREDO	0.523	0.283	0.506	0.010
Rv0242c.1	15	2aax_PDN_B_503 PDB CREDO	0.523	0.283	0.506	0.010
Rv0242c.1	15	1uwh_BAX_B_1723 PDB CREDO	0.613	0.164	0.506	0.010
Rv0242c.1	9	3ria_IVM_C_350 PDB CREDO	0.618	0.158	0.506	0.010
Rv0242c.1	9	3ria_IVM_E_348 PDB CREDO	0.618	0.158	0.506	0.010
Rv0242c.1	15	3tkd_CYZ_A_266 PDB CREDO	0.576	0.209	0.505	0.010
Rv0242c.1	1	2gl0_ADN_B_902 PDB CREDO	0.613	0.164	0.505	0.010
Rv0242c.1	1	3mdv_CL6_B_506 PDB CREDO	0.583	0.200	0.505	0.010
Rv0242c.1	1	3vkx_T3_A_301 PDB CREDO	0.555	0.237	0.505	0.010
Rv0242c.1	2	3ijx_HCZ_B_800 PDB CREDO	0.560	0.230	0.505	0.010
Rv0242c.1	15	1ya3_STR_A_1001 PDB CREDO	0.541	0.257	0.505	0.010
Rv0242c.1	13	3jwq_VIA_D_901 PDB CREDO	0.582	0.201	0.505	0.010
Rv0242c.1	20	2x0p_ADN_A_1607 PDB CREDO	0.505	0.311	0.505	0.010
Rv0242c.1	9	1gs4_ZK5_A_1918 PDB CREDO	0.689	0.090	0.505	0.010
Rv0242c.1	15	2aa6_STR_B_402 PDB CREDO	0.521	0.285	0.504	0.010
Rv0242c.1	9	3ria_IVM_E_349 PDB CREDO	0.616	0.160	0.504	0.010
Rv0242c.1	1	3clb_TMQ_A_611 PDB CREDO	0.552	0.241	0.504	0.010
Rv0242c.1	1	3hbb_TMQ_C_613 PDB CREDO	0.552	0.241	0.504	0.010
Rv0242c.1	1	3u9f_CLM_K_221 PDB CREDO	0.627	0.148	0.504	0.010
Rv0242c.1	1	3clb_TMQ_C_613 PDB CREDO	0.528	0.275	0.504	0.010
Rv0242c.1	1	3u9f_CLM_G_221 PDB CREDO	0.528	0.275	0.504	0.010
Rv0242c.1	13	3tkd_CYZ_A_266 PDB CREDO	0.684	0.093	0.504	0.010
Rv0242c.1	9	3rif_IVM_A_402 PDB CREDO	0.688	0.090	0.504	0.010
Rv0242c.1	9	3rhw_IVM_A_348 PDB CREDO	0.615	0.161	0.504	0.010
Rv0242c.1	9	2w9s_TOP_D_1158 PDB CREDO	0.504	0.313	0.504	0.010
Rv0242c.1	25	3u7s_017_A_201 PDB CREDO	0.672	0.104	0.503	0.010
Rv0242c.1	9	3rif_IVM_B_403 PDB CREDO	0.687	0.091	0.503	0.010
Rv0242c.1	1	2gl0_ADN_D_904 PDB CREDO	0.610	0.167	0.503	0.010
Rv0242c.1	9	1cqe_FLP_A_1650 PDB CREDO	0.525	0.281	0.503	0.010
Rv0242c.1	9	3grv_ADN_A_300 PDB CREDO	0.628	0.147	0.503	0.010
Rv0242c.1	3	1lik_ADN_A_799 PDB CREDO	0.603	0.176	0.503	0.010
Rv0242c.1	15	2hw2_RFP_A_1200 PDB CREDO	0.572	0.214	0.502	0.011
Rv0242c.1	13	3kw2_ADN_A_300 PDB CREDO	0.521	0.286	0.502	0.011
Rv0242c.1	13	3o1c_ADN_A_127 PDB CREDO	0.502	0.315	0.502	0.011
Rv0242c.1	1	4cox_IMN_B_701 PDB CREDO	0.574	0.212	0.502	0.011
Rv0242c.1	1	4cox_IMN_C_701 PDB CREDO	0.574	0.212	0.502	0.011
Rv0242c.1	25	3u7s_017_A_202 PDB CREDO	0.740	0.054	0.502	0.011
Rv0242c.1	15	1mx1_THA_C_3 PDB CREDO	0.557	0.234	0.502	0.011
Rv0242c.1	15	2h42_VIA_A_901 PDB CREDO	0.520	0.288	0.502	0.011
Rv0242c.1	1	3ls4_TCI_H_220 PDB CREDO	0.677	0.100	0.502	0.011
Rv0242c.1	9	3rif_IVM_D_402 PDB CREDO	0.685	0.092	0.502	0.011
Rv0242c.1	13	1fm6_BRL_D_503 PDB CREDO	0.539	0.259	0.502	0.011
Rv0242c.1	9	1cqe_FLP_B_2650 PDB CREDO	0.524	0.282	0.502	0.011
Rv0242c.1	9	1eqh_FLP_B_1701 PDB CREDO	0.524	0.282	0.502	0.011
Rv0242c.1	13	3frq_ERY_B_195 PDB CREDO	0.681	0.096	0.501	0.011
Rv0242c.1	2	3s20_CER_A_1 PDB CREDO	0.556	0.235	0.501	0.011
Rv0242c.1	25	3spk_TPV_A_100 PDB CREDO	0.669	0.107	0.501	0.011
Rv0242c.1	1	2w9s_TOP_F_1159 PDB CREDO	0.524	0.281	0.501	0.011
Rv0242c.1	9	3ria_IVM_C_349 PDB CREDO	0.684	0.094	0.501	0.011
Rv0242c.1	15	1uwj_BAX_A_1723 PDB CREDO	0.703	0.079	0.501	0.011
Rv0242c.1	1	2w8y_NDR_B_1000 PDB CREDO	0.674	0.102	0.500	0.011
Rv0242c.1	13	3ads_IMN_B_3 PDB CREDO	0.687	0.091	0.500	0.011
Rv0242c.1	13	3aod_RFP_C_2002 PDB CREDO	0.500	0.318	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
NADPPubChem	0.901	744.413
protiumPubChem	0.9	2.01576
NADP(H)PubChem	0.9	745.421
ethylene glycol; hydronPubChem	0.9	63.0758
sulfatePubChem	0.9	96.0626
acetyl-CoAPubChem	0.9	809.571
acetyl coenzyme-APubChem	0.9	809.571
coenzyme APubChem	0.9	767.534
Co-APubChem	0.9	767.534
hydron sulfatePubChem	0.9	196.157
hydroxyl radicalsPubChem	0.9	17.0073
polyethylene glycolPubChem	0.9	62.0678
carbon dioxidePubChem	0.9	44.0095
H(+)PubChem	0.9	2.01588
deuteriumPubChem	0.9	2.01588