SInCRe - Rv2974c

Tuberculist information

Gene name	Rv2974c
Protein function	Conserved hypothetical alanine rich protein
Functional category(tuberculist)	conserved hypotheticals
Gene location(kb)	3329.95
Molecular mass(da)	46685
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 470

	  		  	1    LNGARGNSGVILSQILRGIAEVTATAAAASGAVLRAVDANALGAALWRGVELVVASMGGV   60
			  	61   EVPGTIVSVLRAAAGAVDQCAHEGLAGAVTAAGDAAVIALEKTPEQLDVLADAGAVDAGG  120
			  	121  RGLLVLLDALRSTICGQAPARAVYEPSPRALPTDTATQRPAPQFEVMYLLAVCDAAAADQ  180
			  	181  LRDRLKELGESVAIAAAPPDSYSVHVHTDDAGAAVEAGLAVGRVSRIVISALGSGTSGLP  240
			  	241  AGGWTRGRAVLAVVDGDGAAELFAGEGACVLRPGPDAVTPAADISAHQLVRAVVDTGAAH  300
			  	301  VMVLPNGYVAAEELVAGCTAAIGWGVDVVPVPTGSMVQGLAALAVHDAARQAVDDGYSMA  360
			  	361  RAAGASRHGSVRIATQKALTWAGTCKPGDGLGIAGDEVLIVADDVAAAAIGLVDLLLASG  420
			  	421  GDLVTVLIGAGVTEDVAVVLERHVHDHHPGTELVSYRTGHRGDALLIGVE

Known structures in the PDB

No Known structures

Number of amino acids : 470

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Dak2	PF02734	1-132
Dak1_2	PF13684	161-470

Mtb Structural Proteome models

Model Number	1
Model name	Rv2974c.1
Template	2BTD APDB CREDO
Template coverage	73_210
Template Identity(%)	16.2
Model coverage(%)	28.7
Normalized DOPE score	0.216

Model Number	2
Model name	Rv2974c
Template	1FTS APDB CREDO
Template coverage	202_461
Template Identity(%)	11.4
Model coverage(%)	48.3
Normalized DOPE score	0.946

Structure Models from Chopin

Model Number	1
Profile	d.157.1.10 Click for model details
zscore	4.2
Residue begin	161
Residue end	469

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2974c	Gene name	Confidence Score
Rv2975c	Rv2975c	0.988
Rv2973c	recG	0.961
Rv2973c	recG	0.961
Rv2973c	recG	0.961
Rv2417c	Rv2417c	0.925

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2974c.1	2	1n49_RIT_D_401 PDB CREDO	0.790	0.029	0.790	0.000
Rv2974c.1	2	1n49_RIT_B_301 PDB CREDO	0.804	0.023	0.739	0.000
Rv2974c.1	2	3spk_TPV_B_100 PDB CREDO	0.750	0.048	0.729	0.000
Rv2974c.1	2	3lzv_017_A_200 PDB CREDO	0.741	0.053	0.700	0.000
Rv2974c.1	2	3ogp_017_B_200 PDB CREDO	0.698	0.083	0.698	0.000
Rv2974c.1	2	3el0_1UN_A_201 PDB CREDO	0.738	0.054	0.698	0.000
Rv2974c.1	2	2r5q_1UN_B_900 PDB CREDO	0.700	0.081	0.680	0.000
Rv2974c.1	2	3ogp_017_A_200 PDB CREDO	0.742	0.052	0.679	0.000
Rv2974c.1	2	2r5q_1UN_D_900 PDB CREDO	0.697	0.083	0.677	0.000
Rv2974c.1	2	3so9_017_A_100 PDB CREDO	0.758	0.043	0.673	0.000
Rv2974c.1	2	1sgu_MK1_B_2632 PDB CREDO	0.667	0.108	0.667	0.001
Rv2974c.1	2	1c6y_MK1_B_524 PDB CREDO	0.759	0.043	0.661	0.001
Rv2974c.1	2	3ekq_ROC_A_100 PDB CREDO	0.731	0.059	0.653	0.001
Rv2974c.1	2	2o4p_TPV_A_300 PDB CREDO	0.673	0.103	0.653	0.001
Rv2974c.1	2	2o4n_TPV_A_300 PDB CREDO	0.731	0.059	0.649	0.001
Rv2974c.1	2	2b7z_MK1_B_200 PDB CREDO	0.645	0.130	0.645	0.001
Rv2974c.1	2	1hsh_MK1_A_401 PDB CREDO	0.739	0.054	0.643	0.001
Rv2974c.1	2	1d4y_TPV_A_501 PDB CREDO	0.722	0.065	0.641	0.001
Rv2974c.1	2	3ufn_ROC_A_401 PDB CREDO	0.773	0.036	0.638	0.001
Rv2974c.1	2	2qhc_AB1_B_9001 PDB CREDO	0.651	0.124	0.633	0.001
Rv2974c.1	2	2qxs_RAL_A_600 PDB CREDO	0.706	0.076	0.632	0.001
Rv2974c.1	2	2qxs_RAL_B_600 PDB CREDO	0.706	0.076	0.631	0.001
Rv2974c.1	2	2bpx_MK1_B_902 PDB CREDO	0.667	0.109	0.630	0.001
Rv2974c.1	2	3gp0_NIL_A_1 PDB CREDO	0.763	0.041	0.630	0.001
Rv2974c.1	3	3lfa_1N1_A_361 PDB CREDO	0.784	0.031	0.628	0.001
Rv2974c.1	2	1hsh_MK1_C_402 PDB CREDO	0.720	0.066	0.627	0.001
Rv2974c.1	2	3oy4_017_B_200 PDB CREDO	0.645	0.130	0.626	0.001
Rv2974c.1	2	1t7j_478_A_200 PDB CREDO	0.704	0.078	0.625	0.001
Rv2974c.1	2	1sh9_RIT_B_301 PDB CREDO	0.717	0.069	0.624	0.001
Rv2974c.1	2	2z54_AB1_A_200 PDB CREDO	0.642	0.132	0.624	0.001
Rv2974c.1	2	4dqe_017_B_101 PDB CREDO	0.641	0.133	0.623	0.001
Rv2974c.1	2	3ebz_017_B_201 PDB CREDO	0.641	0.134	0.622	0.001
Rv2974c.1	2	2qak_1UN_A_1001 PDB CREDO	0.834	0.014	0.622	0.001
Rv2974c.1	2	1ohr_1UN_A_201 PDB CREDO	0.714	0.070	0.622	0.001
Rv2974c.1	3	1gwr_EST_A_600 PDB CREDO	0.651	0.123	0.622	0.001
Rv2974c.1	2	2q64_1UN_B_1001 PDB CREDO	0.833	0.014	0.621	0.001
Rv2974c.1	2	2pyn_1UN_A_1001 PDB CREDO	0.829	0.015	0.618	0.001
Rv2974c.1	2	2q63_1UN_A_1001 PDB CREDO	0.828	0.016	0.617	0.002
Rv2974c.1	2	3nu9_478_A_401 PDB CREDO	0.652	0.122	0.616	0.002
Rv2974c.1	2	2pym_1UN_A_1001 PDB CREDO	0.827	0.016	0.616	0.002
Rv2974c.1	2	3ogq_AB1_A_200 PDB CREDO	0.784	0.031	0.615	0.002
Rv2974c.1	3	3hm1_J3Z_A_2 PDB CREDO	0.643	0.131	0.614	0.002
Rv2974c.1	2	3em6_017_A_200 PDB CREDO	0.648	0.126	0.613	0.002
Rv2974c.1	2	3ggu_017_B_201 PDB CREDO	0.761	0.042	0.612	0.002
Rv2974c.1	3	1ere_EST_A_600 PDB CREDO	0.641	0.133	0.612	0.002
Rv2974c.1	3	1gwr_EST_B_600 PDB CREDO	0.641	0.133	0.612	0.002
Rv2974c.1	2	3el9_DR7_A_100 PDB CREDO	0.703	0.078	0.612	0.002
Rv2974c.1	2	3s56_ROC_A_201 PDB CREDO	0.703	0.078	0.612	0.002
Rv2974c.1	3	1qku_EST_A_600 PDB CREDO	0.640	0.134	0.611	0.002
Rv2974c.1	3	3ug2_IRE_A_1 PDB CREDO	0.672	0.104	0.610	0.002
Rv2974c.1	3	1qku_EST_B_600 PDB CREDO	0.637	0.138	0.608	0.002
Rv2974c.1	3	1qku_EST_C_600 PDB CREDO	0.637	0.138	0.608	0.002
Rv2974c.1	3	1ere_EST_E_600 PDB CREDO	0.636	0.139	0.607	0.002
Rv2974c.1	3	1pcg_EST_B_2 PDB CREDO	0.635	0.140	0.606	0.002
Rv2974c.1	3	1ere_EST_B_600 PDB CREDO	0.633	0.141	0.605	0.002
Rv2974c.1	3	1g50_EST_B_1600 PDB CREDO	0.633	0.141	0.605	0.002
Rv2974c.1	2	3gcs_BAX_A_401 PDB CREDO	0.641	0.134	0.605	0.002
Rv2974c.1	2	1hpv_478_B_200 PDB CREDO	0.639	0.136	0.604	0.002
Rv2974c.1	2	3ttp_017_A_201 PDB CREDO	0.639	0.136	0.603	0.002
Rv2974c.1	2	1sa1_POD_B_700 PDB CREDO	0.639	0.136	0.602	0.002
Rv2974c.1	2	3s53_017_A_201 PDB CREDO	0.655	0.120	0.602	0.002
Rv2974c.1	2	1hxw_RIT_B_301 PDB CREDO	0.743	0.052	0.597	0.002
Rv2974c.1	2	1mui_AB1_B_100 PDB CREDO	0.671	0.104	0.596	0.002
Rv2974c.1	2	4asd_BAX_A_1500 PDB CREDO	0.632	0.143	0.596	0.002
Rv2974c.1	2	2rkg_AB1_B_501 PDB CREDO	0.670	0.106	0.595	0.002
Rv2974c.1	3	1xbb_STI_A_1 PDB CREDO	0.655	0.120	0.595	0.002
Rv2974c.1	2	1sa1_POD_D_701 PDB CREDO	0.649	0.125	0.595	0.002
Rv2974c.1	2	3lzs_017_A_200 PDB CREDO	0.629	0.146	0.594	0.002
Rv2974c.1	2	3nu6_478_B_401 PDB CREDO	0.664	0.111	0.593	0.002
Rv2974c.1	2	3spk_TPV_A_100 PDB CREDO	0.810	0.021	0.593	0.002
Rv2974c.1	2	3oxw_017_D_200 PDB CREDO	0.646	0.129	0.593	0.002
Rv2974c.1	2	3heg_BAX_A_1 PDB CREDO	0.648	0.127	0.593	0.002
Rv2974c.1	2	3n3i_ROC_A_201 PDB CREDO	0.645	0.130	0.592	0.002
Rv2974c.1	2	4dqh_017_B_101 PDB CREDO	0.644	0.130	0.592	0.002
Rv2974c.1	2	3t3c_017_A_201 PDB CREDO	0.662	0.113	0.592	0.002
Rv2974c.1	2	3oxw_017_B_200 PDB CREDO	0.642	0.132	0.590	0.003
Rv2974c.1	2	1xkk_FMM_A_91 PDB CREDO	0.731	0.059	0.588	0.003
Rv2974c.1	2	1hsg_MK1_B_902 PDB CREDO	0.675	0.101	0.587	0.003
Rv2974c.1	2	2idw_017_B_401 PDB CREDO	0.586	0.196	0.586	0.003
Rv2974c.1	2	1rl8_RIT_A_9001 PDB CREDO	0.805	0.023	0.585	0.003
Rv2974c.1	2	2f80_017_B_301 PDB CREDO	0.784	0.031	0.585	0.003
Rv2974c.1	2	1t46_STI_A_3 PDB CREDO	0.686	0.092	0.581	0.003
Rv2974c.1	3	1a52_EST_B_2 PDB CREDO	0.695	0.084	0.581	0.003
Rv2974c.1	2	4dqc_017_A_101 PDB CREDO	0.650	0.125	0.581	0.003
Rv2974c.1	2	3s45_478_B_201 PDB CREDO	0.615	0.161	0.581	0.003
Rv2974c.1	2	1hxb_ROC_A_100 PDB CREDO	0.778	0.034	0.580	0.003
Rv2974c.1	2	2aoj_FRD_C_305 PDB CREDO	0.597	0.183	0.580	0.003
Rv2974c.1	2	2q5k_AB1_A_201 PDB CREDO	0.648	0.127	0.579	0.003
Rv2974c.1	3	1qkt_EST_A_600 PDB CREDO	0.692	0.087	0.578	0.003
Rv2974c.1	3	2j7x_EST_A_1454 PDB CREDO	0.692	0.087	0.578	0.003
Rv2974c.1	3	3ads_IMN_B_3 PDB CREDO	0.692	0.087	0.578	0.003
Rv2974c.1	2	3oez_STI_A_601 PDB CREDO	0.578	0.206	0.578	0.003
Rv2974c.1	3	1r9o_FLP_A_501 PDB CREDO	0.605	0.173	0.577	0.003
Rv2974c.1	3	2ocf_EST_A_596 PDB CREDO	0.690	0.089	0.576	0.003
Rv2974c.1	3	3hm1_J3Z_B_1 PDB CREDO	0.689	0.090	0.575	0.003
Rv2974c.1	2	3em4_DR7_A_100 PDB CREDO	0.661	0.114	0.575	0.003
Rv2974c.1	3	1a52_EST_A_1 PDB CREDO	0.688	0.090	0.574	0.003
Rv2974c.1	3	1ere_EST_F_600 PDB CREDO	0.688	0.090	0.574	0.003
Rv2974c.1	2	1c6z_ROC_B_505 PDB CREDO	0.770	0.037	0.574	0.003
Rv2974c.1	2	2jfa_RAL_B_600 PDB CREDO	0.665	0.110	0.573	0.003
Rv2974c.1	3	1ere_EST_C_600 PDB CREDO	0.685	0.092	0.573	0.003
Rv2974c.1	3	1pcg_EST_A_1 PDB CREDO	0.685	0.092	0.573	0.003
Rv2974c.1	2	1err_RAL_B_600 PDB CREDO	0.664	0.111	0.572	0.003
Rv2974c.1	3	1ere_EST_D_600 PDB CREDO	0.684	0.093	0.572	0.003
Rv2974c.1	3	1g50_EST_C_2600 PDB CREDO	0.684	0.093	0.572	0.003
Rv2974c.1	3	3oll_EST_A_600 PDB CREDO	0.684	0.093	0.572	0.003
Rv2974c.1	2	1err_RAL_A_600 PDB CREDO	0.663	0.112	0.571	0.004
Rv2974c.1	3	3oll_EST_B_600 PDB CREDO	0.683	0.094	0.571	0.004
Rv2974c.1	2	3sm2_478_A_126 PDB CREDO	0.747	0.050	0.571	0.004
Rv2974c.1	3	1sn0_T44_C_601 PDB CREDO	0.625	0.151	0.570	0.004
Rv2974c.1	2	3ekp_478_B_200 PDB CREDO	0.568	0.219	0.568	0.004
Rv2974c.1	2	3el5_1UN_B_201 PDB CREDO	0.740	0.053	0.566	0.004
Rv2974c.1	2	2aoh_FRD_C_305 PDB CREDO	0.618	0.158	0.566	0.004
Rv2974c.1	2	3bvb_017_B_401 PDB CREDO	0.795	0.027	0.564	0.004
Rv2974c.1	2	3ekx_1UN_B_201 PDB CREDO	0.719	0.067	0.564	0.004
Rv2974c.1	2	2jfa_RAL_A_600 PDB CREDO	0.675	0.101	0.564	0.004
Rv2974c.1	2	2pl0_STI_A_200 PDB CREDO	0.615	0.161	0.563	0.004
Rv2974c.1	2	3nu4_478_B_401 PDB CREDO	0.664	0.111	0.563	0.004
Rv2974c.1	3	3ols_EST_B_600 PDB CREDO	0.763	0.041	0.562	0.004
Rv2974c.1	3	1uay_ADN_A_1001 PDB CREDO	0.588	0.194	0.561	0.004
Rv2974c.1	2	1t7i_017_A_200 PDB CREDO	0.829	0.015	0.561	0.004
Rv2974c.1	3	1g50_EST_A_600 PDB CREDO	0.760	0.043	0.560	0.004
Rv2974c.1	3	3ols_EST_A_600 PDB CREDO	0.760	0.043	0.560	0.004
Rv2974c.1	3	2yja_EST_B_1550 PDB CREDO	0.759	0.043	0.559	0.004
Rv2974c.1	2	3pwr_ROC_A_401 PDB CREDO	0.787	0.030	0.558	0.004
Rv2974c.1	2	1sdv_MK1_B_902 PDB CREDO	0.659	0.116	0.558	0.004
Rv2974c.1	2	3oxv_478_C_200 PDB CREDO	0.658	0.117	0.558	0.004
Rv2974c.1	2	1k6c_MK1_B_902 PDB CREDO	0.823	0.017	0.557	0.004
Rv2974c.1	3	3uud_EST_A_600 PDB CREDO	0.755	0.045	0.557	0.004
Rv2974c.1	3	3uud_EST_B_600 PDB CREDO	0.755	0.045	0.557	0.004
Rv2974c.1	2	3cs9_NIL_A_600 PDB CREDO	0.605	0.173	0.556	0.005
Rv2974c.1	2	4dqb_017_B_101 PDB CREDO	0.655	0.120	0.555	0.005
Rv2974c.1	2	3u7s_017_A_202 PDB CREDO	0.684	0.093	0.553	0.005
Rv2974c.1	2	3el4_ROC_A_100 PDB CREDO	0.817	0.019	0.553	0.005
Rv2974c.1	2	2fxd_DR7_A_102 PDB CREDO	0.634	0.140	0.552	0.005
Rv2974c.1	2	2b60_RIT_B_100 PDB CREDO	0.665	0.110	0.549	0.005
Rv2974c.1	2	3oxv_478_B_200 PDB CREDO	0.597	0.183	0.548	0.005
Rv2974c.1	2	2oiq_STI_A_1001 PDB CREDO	0.598	0.181	0.547	0.005
Rv2974c.1	2	3ucb_017_A_201 PDB CREDO	0.789	0.029	0.547	0.005
Rv2974c.1	2	3nuo_478_B_478 PDB CREDO	0.662	0.113	0.546	0.005
Rv2974c.1	2	1jg2_ADN_A_500 PDB CREDO	0.794	0.027	0.543	0.006
Rv2974c.1	2	2r5p_MK1_D_902 PDB CREDO	0.675	0.102	0.542	0.006
Rv2974c.1	2	2nnk_ROC_A_401 PDB CREDO	0.783	0.032	0.542	0.006
Rv2974c.1	2	3ndt_ROC_D_100 PDB CREDO	0.783	0.032	0.542	0.006
Rv2974c.1	2	3cs9_NIL_C_600 PDB CREDO	0.639	0.136	0.541	0.006
Rv2974c.1	2	2hyy_STI_A_600 PDB CREDO	0.541	0.256	0.541	0.006
Rv2974c.1	2	2y6o_1N1_A_1892 PDB CREDO	0.669	0.106	0.541	0.006
Rv2974c.1	2	3pyy_STI_A_3 PDB CREDO	0.541	0.256	0.541	0.006
Rv2974c.1	2	3cs9_NIL_B_600 PDB CREDO	0.605	0.173	0.541	0.006
Rv2974c.1	2	3cs9_NIL_D_600 PDB CREDO	0.638	0.136	0.541	0.006
Rv2974c.1	2	2nnp_ROC_A_401 PDB CREDO	0.799	0.025	0.540	0.006
Rv2974c.1	2	3mss_STI_C_1 PDB CREDO	0.540	0.258	0.540	0.006
Rv2974c.1	3	2zva_1N1_A_513 PDB CREDO	0.762	0.041	0.540	0.006
Rv2974c.1	2	3mss_STI_B_1 PDB CREDO	0.540	0.259	0.540	0.006
Rv2974c.1	2	1opj_STI_A_3 PDB CREDO	0.587	0.195	0.539	0.006
Rv2974c.1	2	3ms9_STI_A_1 PDB CREDO	0.539	0.259	0.539	0.006
Rv2974c.1	2	2r5p_MK1_B_902 PDB CREDO	0.670	0.105	0.539	0.006
Rv2974c.1	3	2uxp_CLM_B_1211 PDB CREDO	0.565	0.224	0.539	0.006
Rv2974c.1	2	1iep_STI_A_201 PDB CREDO	0.539	0.260	0.539	0.006
Rv2974c.1	2	3k5v_STI_B_2 PDB CREDO	0.538	0.261	0.538	0.006
Rv2974c.1	2	3mss_STI_A_1 PDB CREDO	0.538	0.261	0.538	0.006
Rv2974c.1	2	3eky_DR7_A_100 PDB CREDO	0.669	0.107	0.538	0.006
Rv2974c.1	2	3ms9_STI_B_1 PDB CREDO	0.537	0.262	0.537	0.006
Rv2974c.1	2	1iep_STI_B_202 PDB CREDO	0.537	0.262	0.537	0.006
Rv2974c.1	2	2hyy_STI_D_600 PDB CREDO	0.537	0.262	0.537	0.006
Rv2974c.1	2	3mss_STI_D_1 PDB CREDO	0.537	0.262	0.537	0.006
Rv2974c.1	2	3pyy_STI_B_4 PDB CREDO	0.537	0.262	0.537	0.006
Rv2974c.1	2	3rgf_BAX_A_465 PDB CREDO	0.552	0.241	0.537	0.006
Rv2974c.1	2	3gvu_STI_A_1001 PDB CREDO	0.536	0.264	0.536	0.006
Rv2974c.1	2	2fxe_DR7_A_102 PDB CREDO	0.666	0.109	0.536	0.006
Rv2974c.1	2	1sdu_MK1_B_902 PDB CREDO	0.683	0.094	0.536	0.006
Rv2974c.1	2	2hyy_STI_B_600 PDB CREDO	0.584	0.198	0.535	0.006
Rv2974c.1	2	2hyy_STI_C_600 PDB CREDO	0.535	0.266	0.535	0.006
Rv2974c.1	2	3em4_DR7_V_100 PDB CREDO	0.665	0.111	0.534	0.006
Rv2974c.1	2	1opj_STI_B_4 PDB CREDO	0.581	0.202	0.534	0.006
Rv2974c.1	2	3v5w_8PR_A_701 PDB CREDO	0.682	0.096	0.534	0.006
Rv2974c.1	2	3el1_DR7_A_100 PDB CREDO	0.677	0.100	0.531	0.007
Rv2974c.1	2	3ekw_DR7_B_100 PDB CREDO	0.676	0.101	0.530	0.007
Rv2974c.1	2	3oez_STI_B_601 PDB CREDO	0.633	0.141	0.529	0.007
Rv2974c.1	2	3k5v_STI_A_2 PDB CREDO	0.558	0.233	0.527	0.007
Rv2974c.1	2	1uwj_BAX_A_1723 PDB CREDO	0.542	0.256	0.526	0.007
Rv2974c.1	2	3e22_LOC_D_700 PDB CREDO	0.628	0.147	0.524	0.008
Rv2974c.1	2	2rkf_AB1_A_501 PDB CREDO	0.652	0.123	0.524	0.008
Rv2974c.1	2	3bbt_FMM_D_91 PDB CREDO	0.739	0.054	0.524	0.008
Rv2974c.1	3	2uxp_CLM_A_1211 PDB CREDO	0.548	0.247	0.523	0.008
Rv2974c.1	2	3hec_STI_A_1 PDB CREDO	0.625	0.150	0.522	0.008
Rv2974c.1	2	3e22_LOC_B_700 PDB CREDO	0.625	0.151	0.521	0.008
Rv2974c.1	2	3em3_478_B_200 PDB CREDO	0.664	0.111	0.521	0.008
Rv2974c.1	2	3ekv_478_A_200 PDB CREDO	0.663	0.112	0.520	0.008
Rv2974c.1	2	3k4v_ROC_D_201 PDB CREDO	0.787	0.030	0.520	0.008
Rv2974c.1	3	1cqp_803_A_311 PDB CREDO	0.544	0.253	0.519	0.008
Rv2974c.1	2	3d1y_ROC_A_201 PDB CREDO	0.713	0.071	0.519	0.008
Rv2974c.1	2	4dqf_017_B_101 PDB CREDO	0.661	0.114	0.518	0.008
Rv2974c.1	2	3lzu_017_A_200 PDB CREDO	0.595	0.184	0.518	0.008
Rv2974c.1	2	3h52_486_A_3 PDB CREDO	0.583	0.200	0.518	0.008
Rv2974c.1	3	1sn5_T3_C_601 PDB CREDO	0.646	0.129	0.517	0.008
Rv2974c.1	3	1mx1_THA_B_2 PDB CREDO	0.672	0.104	0.516	0.009
Rv2974c.1	3	1s9p_DES_C_500 PDB CREDO	0.726	0.062	0.515	0.009
Rv2974c.1	2	2aoi_FRD_C_305 PDB CREDO	0.690	0.088	0.515	0.009
Rv2974c.1	3	3vkx_T3_A_301 PDB CREDO	0.538	0.261	0.513	0.009
Rv2974c.1	2	3ekp_478_C_200 PDB CREDO	0.588	0.193	0.512	0.009
Rv2974c.1	2	2aqu_DR7_B_300 PDB CREDO	0.670	0.106	0.512	0.009
Rv2974c.1	2	3tkg_ROC_C_901 PDB CREDO	0.793	0.027	0.512	0.009
Rv2974c.1	2	1uwj_BAX_B_1723 PDB CREDO	0.543	0.254	0.512	0.009
Rv2974c.1	2	2avo_MK1_B_902 PDB CREDO	0.687	0.091	0.512	0.009
Rv2974c.1	3	3adx_IMN_B_3 PDB CREDO	0.691	0.088	0.509	0.009
Rv2974c.1	3	1s9p_DES_B_459 PDB CREDO	0.719	0.067	0.509	0.009
Rv2974c.1	3	1ya4_CTX_B_2 PDB CREDO	0.719	0.067	0.509	0.009
Rv2974c.1	2	3oxx_DR7_A_100 PDB CREDO	0.665	0.110	0.509	0.010
Rv2974c.1	2	1uwh_BAX_A_1723 PDB CREDO	0.572	0.213	0.508	0.010
Rv2974c.1	2	1uwh_BAX_B_1723 PDB CREDO	0.572	0.214	0.508	0.010
Rv2974c.1	2	2w8y_486_A_1000 PDB CREDO	0.538	0.261	0.507	0.010
Rv2974c.1	3	1mx1_THA_A_1 PDB CREDO	0.633	0.141	0.507	0.010
Rv2974c.1	3	1sn5_T3_D_602 PDB CREDO	0.556	0.236	0.507	0.010
Rv2974c.1	3	1ya4_CTX_C_3 PDB CREDO	0.715	0.070	0.507	0.010
Rv2974c.1	2	2avs_MK1_B_902 PDB CREDO	0.679	0.098	0.506	0.010
Rv2974c.1	2	3u7s_017_A_201 PDB CREDO	0.690	0.088	0.506	0.010
Rv2974c.1	2	2aof_FRD_C_305 PDB CREDO	0.764	0.040	0.505	0.010
Rv2974c.1	3	3bbt_FMM_B_91 PDB CREDO	0.770	0.038	0.504	0.010
Rv2974c.1	3	1tbf_VIA_A_501 PDB CREDO	0.528	0.275	0.504	0.010
Rv2974c.1	2	3ut5_LOC_B_502 PDB CREDO	0.566	0.221	0.503	0.010
Rv2974c.1	2	3h52_486_B_1 PDB CREDO	0.547	0.248	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions