SInCRe - Rv2483c

Tuberculist information

Gene name	plsC
Protein function	Possible transmembrane phospholipid biosynthesis bifunctional enzyme PlsC: putative L-3-phosphoserine phosphatase (O-phosphoserine phosphohydrolase) (PSP) (pspase) + 1-acyl-SN-glycerol-3-phosphate acyltransferase (1-AGP acyltransferase) (1-AGPAT) (lysophosphatidic acid acyltransferase) (LPAAT)
Functional category(tuberculist)	lipid metabolism
Gene location(kb)	2789.28
Molecular mass(da)	61788.1
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 580

	  		  	1    MSAADEQGEERATRKSAPDLRLPGSVAEILASPAGPKVGAFFDLDGTLVAGFTAVILTQE   60
			  	61   RLRRRDMGVGELLGMVQAGLNHTLGRIEFEDLIGKAAAALAGRLLTDLEEIGERLFAQRI  120
			  	121  ESRIYPEMRELVRAHVARGHTVVLSSSALTIQVGPVARFLGINNMLTNKFETNEDGILTG  180
			  	181  GVLKPILWCPGKATAVQRFAAEHDIDLKDSYFYADGDEDVALMYLVGNPRPTNPEGKMAA  240
			  	241  VAKRRGWPILKFNSRGGVGIRRQLRTLAGLSTIVPVAAGAVGIGVLTGSRRRGVNFFTST  300
			  	301  FSQLLLATSGVHLNVIGKENLTAQRPAVFIFNHRNQVDPVIAGALVRDNWVGVGKKELAS  360
			  	361  DPIMGTLGKLLDGVFIDRDDPVAAVETLHTVEERARNGLSIVIAPEGTRLDTTEVGSFKK  420
			  	421  GPFRIAMAAKIPIVPIVIRNAEIVASRNSTTINPGTVDVAVFPPIPVDDWTLDALPDRIA  480
			  	481  EVRQLYLDTLADWPVDGLPAVDLYAEQKAARKARAQVAKATAKRVPAKKAPAKSAANKGA  540
			  	541  AATKAATKKASPKAKPSESKIAGKDGEASASPSSSAKGRS

Known structures in the PDB

No Known structures

Number of amino acids : 580

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
HAD	PF12710	40-224
Acyltransferase	PF01553	312-439

Mtb Structural Proteome models

Model Number	1
Model name	Rv2483c.3
Template	1IUQ APDB CREDO
Template coverage	95_364
Template Identity(%)	18.1
Model coverage(%)	39.8
Normalized DOPE score	-0.289

Model Number	2
Model name	Rv2483c
Template	1L7M APDB CREDO
Template coverage	3_184
Template Identity(%)	24.7
Model coverage(%)	33.9
Normalized DOPE score	-0.104

Structure Models from Chopin

Model Number	1
Profile	c.108.1.4 Click for model details
zscore	16.44
Residue begin	40
Residue end	224

Model Number	2
Profile	c.112.1.1 Click for model details
zscore	16.1
Residue begin	312
Residue end	439

Model Number	3
Profile	1.20.1440.100 Click for model details
zscore	10.32
Residue begin	50
Residue end	122

Model Number	4
Profile	c.112.1.1 Click for model details
zscore	8.83
Residue begin	207
Residue end	524

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2483c	Gene name	Confidence Score
Rv2482c	plsB2	0.998
Rv1551	plsB1	0.989
Rv2484c	Rv2484c	0.926
Rv1612	trpB	0.913

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2483c.3	4	1uwj_BAX_A_1723 PDB CREDO	0.673	0.103	0.636	0.001
Rv2483c.3	4	1uwj_BAX_B_1723 PDB CREDO	0.641	0.133	0.623	0.001
Rv2483c.3	4	4asd_BAX_A_1500 PDB CREDO	0.637	0.138	0.619	0.001
Rv2483c.3	4	1y0x_T44_X_500 PDB CREDO	0.658	0.117	0.601	0.002
Rv2483c.3	4	1uwh_BAX_B_1723 PDB CREDO	0.651	0.123	0.595	0.002
Rv2483c.3	4	1uwh_BAX_A_1723 PDB CREDO	0.651	0.124	0.595	0.002
Rv2483c.3	4	3uvv_T3_A_501 PDB CREDO	0.712	0.072	0.593	0.002
Rv2483c.3	4	1xzx_T3_X_500 PDB CREDO	0.710	0.073	0.591	0.002
Rv2483c.3	4	1uob_PNN_A_1311 PDB CREDO	0.625	0.150	0.589	0.003
Rv2483c.3	4	3heg_BAX_A_1 PDB CREDO	0.625	0.150	0.589	0.003
Rv2483c.3	4	3b0w_DGX_B_1 PDB CREDO	0.642	0.133	0.589	0.003
Rv2483c.3	4	3gcs_BAX_A_401 PDB CREDO	0.604	0.174	0.587	0.003
Rv2483c.3	4	1sa1_POD_B_700 PDB CREDO	0.604	0.174	0.587	0.003
Rv2483c.3	4	3frq_ERY_A_195 PDB CREDO	0.581	0.203	0.581	0.003
Rv2483c.3	4	1z2b_VLB_C_800 PDB CREDO	0.612	0.164	0.577	0.003
Rv2483c.3	4	3b0w_DGX_A_1 PDB CREDO	0.594	0.186	0.577	0.003
Rv2483c.3	4	1bsx_T3_A_1 PDB CREDO	0.712	0.072	0.574	0.003
Rv2483c.3	4	1bsx_T3_B_2 PDB CREDO	0.712	0.072	0.574	0.003
Rv2483c.3	4	3gws_T3_X_500 PDB CREDO	0.712	0.072	0.574	0.003
Rv2483c.3	4	1xkk_FMM_A_91 PDB CREDO	0.731	0.059	0.571	0.004
Rv2483c.3	4	3d91_REM_B_350 PDB CREDO	0.587	0.194	0.570	0.004
Rv2483c.3	4	1t46_STI_A_3 PDB CREDO	0.692	0.087	0.570	0.004
Rv2483c.3	4	2hyy_STI_C_600 PDB CREDO	0.587	0.195	0.570	0.004
Rv2483c.3	4	2hw2_RFP_A_1200 PDB CREDO	0.662	0.113	0.569	0.004
Rv2483c.3	4	3mss_STI_B_1 PDB CREDO	0.585	0.197	0.569	0.004
Rv2483c.3	4	1iep_STI_A_201 PDB CREDO	0.585	0.198	0.568	0.004
Rv2483c.3	4	3pyy_STI_B_4 PDB CREDO	0.585	0.198	0.568	0.004
Rv2483c.3	4	3spk_TPV_B_100 PDB CREDO	0.568	0.220	0.568	0.004
Rv2483c.3	4	3mss_STI_C_1 PDB CREDO	0.584	0.198	0.568	0.004
Rv2483c.3	4	1iep_STI_B_202 PDB CREDO	0.584	0.199	0.567	0.004
Rv2483c.3	4	2hyy_STI_B_600 PDB CREDO	0.602	0.177	0.567	0.004
Rv2483c.3	4	3oez_STI_A_601 PDB CREDO	0.584	0.199	0.567	0.004
Rv2483c.3	4	3ms9_STI_A_1 PDB CREDO	0.583	0.200	0.566	0.004
Rv2483c.3	4	3ms9_STI_B_1 PDB CREDO	0.583	0.200	0.566	0.004
Rv2483c.3	4	3pyy_STI_A_3 PDB CREDO	0.583	0.200	0.566	0.004
Rv2483c.3	4	1sa1_POD_D_701 PDB CREDO	0.600	0.179	0.566	0.004
Rv2483c.3	4	3mss_STI_D_1 PDB CREDO	0.582	0.201	0.566	0.004
Rv2483c.3	4	3gvu_STI_A_1001 PDB CREDO	0.582	0.201	0.565	0.004
Rv2483c.3	4	2hyy_STI_D_600 PDB CREDO	0.581	0.202	0.565	0.004
Rv2483c.3	4	2oiq_STI_A_1001 PDB CREDO	0.599	0.180	0.565	0.004
Rv2483c.3	4	3tkd_CYZ_B_267 PDB CREDO	0.617	0.159	0.564	0.004
Rv2483c.3	4	2h79_T3_A_1 PDB CREDO	0.723	0.064	0.564	0.004
Rv2483c.3	4	3mss_STI_A_1 PDB CREDO	0.580	0.204	0.564	0.004
Rv2483c.3	4	3k5v_STI_B_2 PDB CREDO	0.580	0.204	0.563	0.004
Rv2483c.3	4	2hyy_STI_A_600 PDB CREDO	0.579	0.205	0.563	0.004
Rv2483c.3	4	3d91_REM_A_350 PDB CREDO	0.579	0.204	0.563	0.004
Rv2483c.3	4	2qxs_RAL_A_600 PDB CREDO	0.638	0.137	0.554	0.005
Rv2483c.3	4	2qxs_RAL_B_600 PDB CREDO	0.637	0.138	0.553	0.005
Rv2483c.3	4	2w8y_486_A_1000 PDB CREDO	0.568	0.219	0.552	0.005
Rv2483c.3	4	2pl0_STI_A_200 PDB CREDO	0.585	0.198	0.551	0.005
Rv2483c.3	4	3h52_486_B_1 PDB CREDO	0.585	0.198	0.551	0.005
Rv2483c.3	4	2h77_T3_A_1 PDB CREDO	0.728	0.061	0.549	0.005
Rv2483c.3	4	3cs9_NIL_A_600 PDB CREDO	0.614	0.162	0.548	0.005
Rv2483c.3	4	1hwk_117_B_1 PDB CREDO	0.564	0.225	0.548	0.005
Rv2483c.3	4	1fm6_BRL_X_504 PDB CREDO	0.656	0.118	0.546	0.005
Rv2483c.3	4	3frq_ERY_B_195 PDB CREDO	0.636	0.139	0.546	0.005
Rv2483c.3	4	3h52_486_D_2 PDB CREDO	0.598	0.182	0.546	0.005
Rv2483c.3	4	2jfa_RAL_B_600 PDB CREDO	0.613	0.164	0.543	0.006
Rv2483c.3	4	2nni_MTK_A_501 PDB CREDO	0.542	0.255	0.542	0.006
Rv2483c.3	4	3tne_RIT_A_401 PDB CREDO	0.631	0.144	0.542	0.006
Rv2483c.3	4	3vn2_TLS_A_501 PDB CREDO	0.612	0.165	0.542	0.006
Rv2483c.3	4	3ut5_LOC_B_502 PDB CREDO	0.592	0.189	0.541	0.006
Rv2483c.3	4	1opj_STI_A_3 PDB CREDO	0.605	0.173	0.540	0.006
Rv2483c.3	4	2xkw_P1B_A_1478 PDB CREDO	0.708	0.074	0.539	0.006
Rv2483c.3	4	3qt0_486_A_4 PDB CREDO	0.739	0.054	0.539	0.006
Rv2483c.3	4	1err_RAL_B_600 PDB CREDO	0.607	0.170	0.538	0.006
Rv2483c.3	4	3k5v_STI_A_2 PDB CREDO	0.586	0.196	0.538	0.006
Rv2483c.3	4	2jfa_RAL_A_600 PDB CREDO	0.625	0.150	0.538	0.006
Rv2483c.3	4	3cs9_NIL_B_600 PDB CREDO	0.616	0.160	0.535	0.006
Rv2483c.3	4	2oax_SNL_E_5001 PDB CREDO	0.568	0.220	0.535	0.006
Rv2483c.3	4	2y6o_1N1_A_1892 PDB CREDO	0.643	0.132	0.535	0.006
Rv2483c.3	4	1opj_STI_B_4 PDB CREDO	0.598	0.181	0.534	0.006
Rv2483c.3	4	3oez_STI_B_601 PDB CREDO	0.621	0.155	0.534	0.007
Rv2483c.3	4	1zgy_BRL_A_503 PDB CREDO	0.706	0.076	0.532	0.007
Rv2483c.3	4	1err_RAL_A_600 PDB CREDO	0.599	0.180	0.531	0.007
Rv2483c.3	4	3h52_486_A_3 PDB CREDO	0.581	0.203	0.531	0.007
Rv2483c.3	4	3e22_LOC_B_700 PDB CREDO	0.618	0.159	0.531	0.007
Rv2483c.3	4	3e22_LOC_D_700 PDB CREDO	0.617	0.159	0.530	0.007
Rv2483c.3	4	3tkd_CYZ_A_266 PDB CREDO	0.617	0.160	0.530	0.007
Rv2483c.3	4	3ut5_LOC_D_502 PDB CREDO	0.617	0.160	0.530	0.007
Rv2483c.3	4	3kk6_CEL_B_1701 PDB CREDO	0.609	0.168	0.529	0.007
Rv2483c.3	4	2oax_SNL_D_4001 PDB CREDO	0.560	0.230	0.528	0.007
Rv2483c.3	4	3bbt_FMM_D_91 PDB CREDO	0.724	0.064	0.528	0.007
Rv2483c.3	4	2oax_SNL_F_6001 PDB CREDO	0.559	0.231	0.527	0.007
Rv2483c.3	4	1lhv_NOG_A_301 PDB CREDO	0.632	0.142	0.526	0.007
Rv2483c.3	4	3hec_STI_A_1 PDB CREDO	0.610	0.167	0.524	0.008
Rv2483c.3	4	2oax_SNL_A_1001 PDB CREDO	0.554	0.238	0.522	0.008
Rv2483c.3	4	3bjw_SVR_E_503 PDB CREDO	0.617	0.159	0.522	0.008
Rv2483c.3	4	1n49_RIT_D_401 PDB CREDO	0.535	0.265	0.520	0.008
Rv2483c.3	4	1qkn_RAL_A_600 PDB CREDO	0.644	0.131	0.519	0.008
Rv2483c.3	4	3cs9_NIL_C_600 PDB CREDO	0.630	0.145	0.519	0.008
Rv2483c.3	4	3spk_TPV_A_100 PDB CREDO	0.687	0.091	0.518	0.008
Rv2483c.3	4	1hwl_FBI_B_1 PDB CREDO	0.550	0.245	0.518	0.008
Rv2483c.3	4	1hwl_FBI_D_3 PDB CREDO	0.549	0.246	0.517	0.008
Rv2483c.3	4	3sm2_478_A_126 PDB CREDO	0.696	0.084	0.517	0.008
Rv2483c.3	4	1hwk_117_A_2 PDB CREDO	0.532	0.270	0.516	0.009
Rv2483c.3	4	3ln1_CEL_C_682 PDB CREDO	0.640	0.134	0.516	0.009
Rv2483c.3	4	1hwk_117_C_4 PDB CREDO	0.531	0.271	0.516	0.009
Rv2483c.3	4	3ln1_CEL_B_682 PDB CREDO	0.640	0.135	0.516	0.009
Rv2483c.3	4	3ln1_CEL_A_682 PDB CREDO	0.639	0.136	0.515	0.009
Rv2483c.3	4	3cs9_NIL_D_600 PDB CREDO	0.625	0.150	0.514	0.009
Rv2483c.3	4	3mnp_DEX_A_784 PDB CREDO	0.578	0.206	0.512	0.009
Rv2483c.3	4	3gp0_NIL_A_1 PDB CREDO	0.639	0.136	0.512	0.009
Rv2483c.3	4	3mno_DEX_A_784 PDB CREDO	0.577	0.207	0.512	0.009
Rv2483c.3	4	1a28_STR_B_2 PDB CREDO	0.612	0.165	0.509	0.009
Rv2483c.3	4	3jwq_VIA_D_901 PDB CREDO	0.697	0.083	0.509	0.010
Rv2483c.3	4	1hwl_FBI_A_2 PDB CREDO	0.538	0.261	0.507	0.010
Rv2483c.3	4	3oht_1N1_B_1000 PDB CREDO	0.744	0.051	0.506	0.010
Rv2483c.3	4	1hwl_FBI_C_4 PDB CREDO	0.536	0.263	0.506	0.010
Rv2483c.3	4	2ab2_SNL_B_503 PDB CREDO	0.586	0.196	0.503	0.010
Rv2483c.3	4	1hwi_115_B_1 PDB CREDO	0.584	0.199	0.502	0.011
Rv2483c.3	4	2fum_MIX_D_3539 PDB CREDO	0.687	0.091	0.501	0.011
Rv2483c.3	4	2ab2_SNL_A_502 PDB CREDO	0.582	0.201	0.500	0.011
Rv2483c.3	4	3h0a_9RA_A_500 PDB CREDO	0.686	0.092	0.500	0.011
Rv2483c.3	4	3ln1_CEL_D_682 PDB CREDO	0.686	0.092	0.500	0.011
Rv2483c.3	4	3v5w_8PR_A_701 PDB CREDO	0.621	0.155	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
1-acyl-sn-glycerol 3-phosphatesPubChem	0.9	200.084
cytidine triphosphatePubChem	0.9	483.156
FORMYL COENZYME APubChem	0.9	795.544
glycerol 1-phosphatePubChem	0.9	172.074
hydroxyl radicalsPubChem	0.9	17.0073
CHEBI:29089PubChem	0.9	228.094
pyrophosphatePubChem	0.9	177.975
coenzyme APubChem	0.9	767.534
phosphatidatePubChem	0.9	228.094
L-serinePubChem	0.9	105.093
Co-APubChem	0.9	767.534
glycerol-3-phosphatePubChem	0.9	172.074
Formyl-coenzyme APubChem	0.9	795.544
phosphatePubChem	0.9	96.9872
O-phosphoserinePubChem	0.9	185.072
1,2-diacyl-sn-glycerolPubChem	0.9	148.114
ara-CTPPubChem	0.9	483.156