SInCRe - Rv2323c

Tuberculist information

Gene name	Rv2323c
Protein function	Conserved protein
Functional category(tuberculist)	conserved hypotheticals
Gene location(kb)	2595.36
Molecular mass(da)	32959.6
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 302

	  		  	1    MENTQRPSFDCEIRAKYRWFMTDSYVAAARLGSPARRTPRTRRYAMTPPAFFAVAYAINP   60
			  	61   WMDVTAPVDVQVAQAQWEHLHQTYLRLGHSVDLIEPISGLPDMVYTANGGFIAHDIAVVA  120
			  	121  RFRFPERAGESRAYASWMSSVGYRPVTTRHVNEGQGDLLMVGERVLAGYGFRTDQRAHAE  180
			  	181  IAAVLGLPVVSLELVDPRFYHLDTALAVLDDHTIAYYPPAFSTAAQEQLSALFPDAIVVG  240
			  	241  SADAFVFGLNAVSDGLNVVLPVAAMGFAAQLRAAGFEPVGVDLSELLKGGGSVKCCTLEI  300
			  	301  HP

Known structures in the PDB

No Known structures

Number of amino acids : 302

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Amidinotransf	PF02274	46-302

Mtb Structural Proteome models

Model Number	1
Model name	Rv2323c
Template	2CI1 APDB CREDO
Template coverage	11_277
Template Identity(%)	20.8
Model coverage(%)	85.8
Normalized DOPE score	0.133

Model Number	2
Model name	Rv2323c.1
Template	2A9G APDB CREDO
Template coverage	48_412
Template Identity(%)	17.9
Model coverage(%)	99.3
Normalized DOPE score	1.039

Structure Models from Chopin

Model Number	1
Profile	d.126.1.3 - 3.75.10.10 Click for model details
zscore	37.24
Residue begin	39
Residue end	300

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2323c	Gene name	Confidence Score
Rv2321c	rocD2	0.966
Rv2322c	rocD1	0.926

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2323c.1	5	1oq5_CEL_A_701 PDB CREDO	0.552	0.241	0.552	0.005
Rv2323c.1	6	2x9g_LYA_A_1270 PDB CREDO	0.564	0.225	0.546	0.005
Rv2323c.1	5	1lhu_EST_A_301 PDB CREDO	0.557	0.234	0.538	0.006
Rv2323c.1	5	4e3a_ADN_B_500 PDB CREDO	0.570	0.216	0.530	0.007
Rv2323c.1	6	3apw_DP0_A_190 PDB CREDO	0.584	0.199	0.530	0.007
Rv2323c.1	5	4eb6_VLB_C_503 PDB CREDO	0.522	0.284	0.522	0.008
Rv2323c.1	6	2x9g_LYA_B_1270 PDB CREDO	0.592	0.189	0.519	0.008
Rv2323c.1	6	3ua1_08Y_A_600 PDB CREDO	0.536	0.264	0.519	0.008
Rv2323c.1	5	1dwc_MIT_H_1 PDB CREDO	0.580	0.204	0.519	0.008
Rv2323c.1	4	1s2a_IMN_A_2001 PDB CREDO	0.518	0.290	0.518	0.008
Rv2323c.1	5	4eyb_0WO_B_301 PDB CREDO	0.535	0.266	0.516	0.009
Rv2323c.1	6	2gqg_1N1_B_502 PDB CREDO	0.567	0.220	0.515	0.009
Rv2323c.1	5	3n58_ADN_A_500 PDB CREDO	0.533	0.268	0.514	0.009
Rv2323c.1	6	1etr_MIT_H_1 PDB CREDO	0.546	0.249	0.512	0.009
Rv2323c.1	5	1lhv_NOG_A_301 PDB CREDO	0.649	0.125	0.512	0.009
Rv2323c.1	5	1fr6_AZR_B_362 PDB CREDO	0.570	0.216	0.510	0.009
Rv2323c.1	5	1fr6_AZR_A_362 PDB CREDO	0.570	0.217	0.510	0.009
Rv2323c.1	5	1d4f_ADN_C_603 PDB CREDO	0.527	0.277	0.509	0.010
Rv2323c.1	5	3n58_ADN_D_500 PDB CREDO	0.547	0.248	0.508	0.010
Rv2323c.1	5	3kw2_ADN_A_300 PDB CREDO	0.546	0.250	0.507	0.010
Rv2323c.1	5	3ce6_ADN_C_500 PDB CREDO	0.542	0.255	0.504	0.010
Rv2323c.1	6	2vn1_FK5_A_501 PDB CREDO	0.656	0.118	0.503	0.010
Rv2323c.1	5	3ce6_ADN_B_500 PDB CREDO	0.542	0.256	0.503	0.010
Rv2323c.1	5	3k54_1N1_A_1 PDB CREDO	0.522	0.285	0.503	0.010
Rv2323c.1	5	4eyb_0WO_A_303 PDB CREDO	0.521	0.285	0.503	0.010
Rv2323c.1	5	3ce6_ADN_D_500 PDB CREDO	0.541	0.257	0.503	0.010
Rv2323c.1	5	3ce6_ADN_A_500 PDB CREDO	0.540	0.258	0.502	0.011
Rv2323c.1	5	1jin_KTN_A_801 PDB CREDO	0.605	0.173	0.501	0.011
Rv2323c.1	5	3k2h_LYA_B_514 PDB CREDO	0.519	0.289	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions