SInCRe - Rv1736c

Tuberculist information

Gene name	narX
Protein function	Probable nitrate reductase NarX
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	1962.23
Molecular mass(da)	72793.3
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 652

	  		  	1    VTVTPRTGSRIEELLARSGRFFIPGEISADLRTVTRRGGRDGDVFYRDRWSHDKVVRSTH   60
			  	61   GVNCTGSCSWKIYVKDDIITWETQETDYPSVGPDRPEYEPRGCPRGAAFSWYTYSPTRVR  120
			  	121  HPYARGVLVEMYREAKARLGDPVAAWADIQADPRRRRRYQRARGKGGLVRVSWAEATEMI  180
			  	181  AAAHVHTISTYGPDRVAGFSPIPAMSMVSHAAGSRFVELIGGVMTSFYDWYADLPVASPQ  240
			  	241  VFGDQTDVPESGDWWDVVWQCASVLLTYPNSRQLGTAEELLAHIDGPAADLLGRTVSELR  300
			  	301  RADPLTAATRYVDTFDLRGRATLYLTYWTAGDTRNRGREMLAFAQTYRSTDVAPPRGETP  360
			  	361  DFLPVVLEFAATVDPEAGRRLLSGYRVPIAALCNALTEAALPYAHTVAAVCRTGDMMGEL  420
			  	421  FWTVVPYVTMTIVAVGSWWRYRYDKFGWTTRSSQLYESRLLRIASPMFHFGILVVIVGHG  480
			  	481  IGLVIPQSWTQAAGLSEGAYHVQAVVLGSIAGITTLAGVTLLIYRRRTRGPVFMATTVND  540
			  	541  KVMYLVLVAAIVAGLGATALGSGVVGEAYNYRETVSVWFRSVWVLQPRGDLMAEAPLYYQ  600
			  	601  IHVLIGLALFALWPFTRLVHAFSAPIGYLFRPYIIYRSREELVLTRPRRRGW

Known structures in the PDB

No Known structures

Number of amino acids : 652

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Molybdopterin	PF00384	118-267
Nitrate_red_del	PF02613	258-413
Nitrate_red_gam	PF02665	416-640

Mtb Structural Proteome models

Model Number	1
Model name	Rv1736c.2
Template	1Q16 CPDB CREDO
Template coverage	2_225
Template Identity(%)	29.6
Model coverage(%)	34.5
Normalized DOPE score	0.628

Model Number	2
Model name	Rv1736c
Template	1Q16 APDB CREDO
Template coverage	1_525
Template Identity(%)	34.3
Model coverage(%)	89.9
Normalized DOPE score	1.927

Structure Models from Chopin

Model Number	1
Profile	f.21.3.1 - 1.20.950.20 Click for model details
zscore	31.61
Residue begin	416
Residue end	639

Model Number	2
Profile	c.81.1.1 Click for model details
zscore	16.48
Residue begin	118
Residue end	267

Model Number	3
Profile	a.184.1.1 - 1.10.3480.10 Click for model details
zscore	8.48
Residue begin	258
Residue end	413

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1736c	Gene name	Confidence Score
Rv1737c	narK2	0.978
Rv0252	nirB	0.903
Rv0252	nirB	0.903
Rv0252	nirB	0.903
Rv0252	nirB	0.903
Rv0252	nirB	0.903
Rv2391	sirA	0.901
Rv2391	sirA	0.901

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1736c.2	2	4a79_P1B_B_601 PDB CREDO	0.663	0.112	0.663	0.001
Rv1736c.2	2	2h42_VIA_C_903 PDB CREDO	0.655	0.120	0.655	0.001
Rv1736c.2	3	3b0w_DGX_B_1 PDB CREDO	0.679	0.098	0.643	0.001
Rv1736c.2	2	1sqn_NDR_A_1001 PDB CREDO	0.666	0.110	0.642	0.001
Rv1736c.2	2	1gs4_ZK5_A_1918 PDB CREDO	0.639	0.136	0.639	0.001
Rv1736c.2	2	3h52_486_C_4 PDB CREDO	0.638	0.136	0.638	0.001
Rv1736c.2	2	3n8z_FLP_A_701 PDB CREDO	0.710	0.073	0.635	0.001
Rv1736c.2	2	1a28_STR_A_1 PDB CREDO	0.658	0.117	0.635	0.001
Rv1736c.2	2	1sqn_NDR_B_2001 PDB CREDO	0.658	0.117	0.635	0.001
Rv1736c.2	2	2h42_VIA_B_902 PDB CREDO	0.632	0.143	0.632	0.001
Rv1736c.2	2	2q1v_PDN_A_248 PDB CREDO	0.674	0.102	0.628	0.001
Rv1736c.2	3	2xkw_P1B_A_1478 PDB CREDO	0.716	0.069	0.628	0.001
Rv1736c.2	2	2x2n_X2N_C_1479 PDB CREDO	0.688	0.090	0.620	0.001
Rv1736c.2	2	3jwq_VIA_B_901 PDB CREDO	0.617	0.159	0.617	0.002
Rv1736c.2	2	4a79_P1B_A_601 PDB CREDO	0.689	0.089	0.617	0.002
Rv1736c.2	2	3d90_NOG_A_1001 PDB CREDO	0.704	0.078	0.612	0.002
Rv1736c.2	3	3cs9_NIL_B_600 PDB CREDO	0.608	0.170	0.608	0.002
Rv1736c.2	2	3h0a_9RA_A_500 PDB CREDO	0.675	0.101	0.608	0.002
Rv1736c.2	2	3d90_NOG_B_2001 PDB CREDO	0.696	0.084	0.606	0.002
Rv1736c.2	2	2ayl_FLP_A_1701 PDB CREDO	0.699	0.081	0.602	0.002
Rv1736c.2	2	3ln1_CEL_D_682 PDB CREDO	0.668	0.108	0.601	0.002
Rv1736c.2	3	3cs9_NIL_A_600 PDB CREDO	0.617	0.159	0.600	0.002
Rv1736c.2	2	3nt1_NPS_B_4 PDB CREDO	0.753	0.046	0.599	0.002
Rv1736c.2	2	3ln1_CEL_A_682 PDB CREDO	0.733	0.058	0.597	0.002
Rv1736c.2	2	3ln1_CEL_C_682 PDB CREDO	0.732	0.058	0.597	0.002
Rv1736c.2	2	1nhz_486_A_800 PDB CREDO	0.685	0.093	0.596	0.002
Rv1736c.2	2	3ln1_CEL_B_682 PDB CREDO	0.732	0.059	0.596	0.002
Rv1736c.2	2	3nrr_D16_B_520 PDB CREDO	0.639	0.136	0.595	0.002
Rv1736c.2	2	3nt1_NPS_A_5 PDB CREDO	0.748	0.049	0.595	0.002
Rv1736c.2	2	3adx_IMN_A_2 PDB CREDO	0.590	0.192	0.590	0.003
Rv1736c.2	2	2prg_BRL_B_2 PDB CREDO	0.611	0.166	0.590	0.003
Rv1736c.2	3	3bjw_SVR_E_503 PDB CREDO	0.603	0.175	0.587	0.003
Rv1736c.2	2	1ya3_STR_C_3001 PDB CREDO	0.608	0.169	0.586	0.003
Rv1736c.2	2	3ads_IMN_A_2 PDB CREDO	0.629	0.146	0.586	0.003
Rv1736c.2	2	3n8z_FLP_B_1701 PDB CREDO	0.736	0.056	0.586	0.003
Rv1736c.2	2	2h42_VIA_A_901 PDB CREDO	0.651	0.124	0.586	0.003
Rv1736c.2	2	3jwq_VIA_D_901 PDB CREDO	0.651	0.124	0.586	0.003
Rv1736c.2	2	1p93_DEX_A_1999 PDB CREDO	0.649	0.125	0.584	0.003
Rv1736c.2	2	1p93_DEX_B_2999 PDB CREDO	0.649	0.125	0.584	0.003
Rv1736c.2	2	2aax_PDN_B_503 PDB CREDO	0.691	0.088	0.581	0.003
Rv1736c.2	2	2aa6_STR_B_402 PDB CREDO	0.690	0.088	0.581	0.003
Rv1736c.2	2	2aax_PDN_A_502 PDB CREDO	0.690	0.088	0.581	0.003
Rv1736c.2	2	1ya3_STR_A_1001 PDB CREDO	0.623	0.152	0.581	0.003
Rv1736c.2	2	1ya3_STR_B_2001 PDB CREDO	0.623	0.152	0.581	0.003
Rv1736c.2	2	2aa6_STR_A_401 PDB CREDO	0.688	0.090	0.579	0.003
Rv1736c.2	2	3mne_DEX_A_784 PDB CREDO	0.710	0.073	0.579	0.003
Rv1736c.2	2	3aod_RFP_C_2002 PDB CREDO	0.597	0.182	0.576	0.003
Rv1736c.2	3	1skx_RFP_A_1 PDB CREDO	0.574	0.212	0.574	0.003
Rv1736c.2	3	1opj_STI_A_3 PDB CREDO	0.589	0.192	0.573	0.003
Rv1736c.2	2	3gn8_DEX_A_247 PDB CREDO	0.702	0.079	0.572	0.003
Rv1736c.2	3	1y0x_T44_X_500 PDB CREDO	0.720	0.066	0.572	0.003
Rv1736c.2	3	3cs9_NIL_C_600 PDB CREDO	0.602	0.177	0.571	0.004
Rv1736c.2	2	1a28_STR_B_2 PDB CREDO	0.723	0.064	0.570	0.004
Rv1736c.2	2	1fdu_EST_C_353 PDB CREDO	0.661	0.114	0.569	0.004
Rv1736c.2	3	1opj_STI_B_4 PDB CREDO	0.585	0.198	0.569	0.004
Rv1736c.2	2	3gn8_DEX_B_247 PDB CREDO	0.697	0.083	0.568	0.004
Rv1736c.2	2	3ls4_TCI_H_220 PDB CREDO	0.685	0.093	0.567	0.004
Rv1736c.2	2	3upr_1KX_C_277 PDB CREDO	0.658	0.116	0.567	0.004
Rv1736c.2	3	3cs9_NIL_D_600 PDB CREDO	0.598	0.182	0.566	0.004
Rv1736c.2	3	3bjw_SVR_B_501 PDB CREDO	0.628	0.147	0.565	0.004
Rv1736c.2	2	2aa5_STR_B_302 PDB CREDO	0.669	0.106	0.563	0.004
Rv1736c.2	2	1q23_FUA_A_702 PDB CREDO	0.584	0.199	0.563	0.004
Rv1736c.2	2	1m2z_DEX_D_401 PDB CREDO	0.692	0.087	0.563	0.004
Rv1736c.2	2	1p93_DEX_D_4999 PDB CREDO	0.691	0.088	0.563	0.004
Rv1736c.2	3	2qxs_RAL_B_600 PDB CREDO	0.562	0.227	0.562	0.004
Rv1736c.2	2	1m2z_DEX_A_301 PDB CREDO	0.689	0.089	0.561	0.004
Rv1736c.2	2	1p93_DEX_C_3999 PDB CREDO	0.688	0.090	0.561	0.004
Rv1736c.2	3	2qxs_RAL_A_600 PDB CREDO	0.560	0.230	0.560	0.004
Rv1736c.2	2	2aa5_STR_A_301 PDB CREDO	0.666	0.110	0.560	0.004
Rv1736c.2	2	3upr_1KX_A_277 PDB CREDO	0.649	0.125	0.559	0.004
Rv1736c.2	3	2hw2_RFP_A_1200 PDB CREDO	0.747	0.049	0.558	0.004
Rv1736c.2	3	3gcs_BAX_A_401 PDB CREDO	0.661	0.114	0.558	0.004
Rv1736c.2	3	3bjw_SVR_H_504 PDB CREDO	0.616	0.160	0.554	0.005
Rv1736c.2	3	3k5v_STI_A_2 PDB CREDO	0.586	0.197	0.554	0.005
Rv1736c.2	2	2x2n_X2N_D_1479 PDB CREDO	0.669	0.107	0.554	0.005
Rv1736c.2	3	3oez_STI_A_601 PDB CREDO	0.618	0.158	0.553	0.005
Rv1736c.2	2	3vri_1KX_A_301 PDB CREDO	0.667	0.108	0.553	0.005
Rv1736c.2	3	3bjw_SVR_F_502 PDB CREDO	0.614	0.163	0.552	0.005
Rv1736c.2	2	2x2n_X2N_A_1480 PDB CREDO	0.722	0.065	0.552	0.005
Rv1736c.2	2	2w8y_NDR_B_1000 PDB CREDO	0.666	0.109	0.551	0.005
Rv1736c.2	3	1xzx_T3_X_500 PDB CREDO	0.762	0.041	0.551	0.005
Rv1736c.2	3	3uvv_T3_A_501 PDB CREDO	0.762	0.041	0.551	0.005
Rv1736c.2	3	2oiq_STI_A_1001 PDB CREDO	0.673	0.103	0.551	0.005
Rv1736c.2	3	1xkk_FMM_A_91 PDB CREDO	0.612	0.165	0.550	0.005
Rv1736c.2	2	2x2n_X2N_B_1479 PDB CREDO	0.719	0.067	0.549	0.005
Rv1736c.2	3	3gp0_NIL_A_1 PDB CREDO	0.595	0.186	0.549	0.005
Rv1736c.2	2	1xp0_VDN_A_201 PDB CREDO	0.778	0.034	0.546	0.005
Rv1736c.2	2	1a27_EST_A_350 PDB CREDO	0.633	0.142	0.545	0.005
Rv1736c.2	2	1q23_FUA_I_707 PDB CREDO	0.564	0.225	0.544	0.006
Rv1736c.2	3	1iep_STI_B_202 PDB CREDO	0.605	0.173	0.541	0.006
Rv1736c.2	2	4eb6_VLB_C_503 PDB CREDO	0.540	0.259	0.540	0.006
Rv1736c.2	2	2zbv_ADN_A_501 PDB CREDO	0.559	0.232	0.539	0.006
Rv1736c.2	3	3pyy_STI_A_3 PDB CREDO	0.602	0.176	0.539	0.006
Rv1736c.2	3	3k5v_STI_B_2 PDB CREDO	0.602	0.177	0.538	0.006
Rv1736c.2	3	3mss_STI_D_1 PDB CREDO	0.602	0.177	0.538	0.006
Rv1736c.2	3	3mss_STI_A_1 PDB CREDO	0.602	0.177	0.538	0.006
Rv1736c.2	3	3mss_STI_C_1 PDB CREDO	0.602	0.177	0.538	0.006
Rv1736c.2	2	2x9g_LYA_B_1270 PDB CREDO	0.618	0.158	0.538	0.006
Rv1736c.2	3	3kk6_CEL_B_1701 PDB CREDO	0.538	0.262	0.538	0.006
Rv1736c.2	3	2hyy_STI_D_600 PDB CREDO	0.601	0.178	0.537	0.006
Rv1736c.2	3	1iep_STI_A_201 PDB CREDO	0.600	0.178	0.537	0.006
Rv1736c.2	3	3heg_BAX_A_1 PDB CREDO	0.656	0.119	0.537	0.006
Rv1736c.2	3	3ms9_STI_B_1 PDB CREDO	0.600	0.178	0.537	0.006
Rv1736c.2	3	2hyy_STI_A_600 PDB CREDO	0.600	0.179	0.536	0.006
Rv1736c.2	3	3ms9_STI_A_1 PDB CREDO	0.600	0.179	0.536	0.006
Rv1736c.2	3	3pyy_STI_B_4 PDB CREDO	0.599	0.180	0.536	0.006
Rv1736c.2	3	1bsx_T3_A_1 PDB CREDO	0.765	0.040	0.535	0.006
Rv1736c.2	3	1bsx_T3_B_2 PDB CREDO	0.765	0.040	0.535	0.006
Rv1736c.2	3	3gvu_STI_A_1001 PDB CREDO	0.599	0.180	0.535	0.006
Rv1736c.2	3	3mss_STI_B_1 PDB CREDO	0.599	0.180	0.535	0.006
Rv1736c.2	2	2ayl_FLP_B_2701 PDB CREDO	0.700	0.081	0.534	0.006
Rv1736c.2	3	2hyy_STI_C_600 PDB CREDO	0.598	0.182	0.534	0.006
Rv1736c.2	3	1t46_STI_A_3 PDB CREDO	0.562	0.227	0.533	0.007
Rv1736c.2	2	2ab2_SNL_B_503 PDB CREDO	0.697	0.083	0.532	0.007
Rv1736c.2	2	3mnp_DEX_A_784 PDB CREDO	0.719	0.067	0.532	0.007
Rv1736c.2	3	3b0w_DGX_A_1 PDB CREDO	0.631	0.144	0.532	0.007
Rv1736c.2	2	1pxx_DIF_C_2701 PDB CREDO	0.758	0.044	0.532	0.007
Rv1736c.2	2	2prg_BRL_A_1 PDB CREDO	0.550	0.244	0.531	0.007
Rv1736c.2	2	2ab2_SNL_A_502 PDB CREDO	0.694	0.085	0.530	0.007
Rv1736c.2	2	3vn2_TLS_A_501 PDB CREDO	0.716	0.069	0.530	0.007
Rv1736c.2	3	3gws_T3_X_500 PDB CREDO	0.757	0.044	0.530	0.007
Rv1736c.2	2	3mno_DEX_A_784 PDB CREDO	0.715	0.070	0.529	0.007
Rv1736c.2	2	1pxx_DIF_B_1701 PDB CREDO	0.754	0.046	0.529	0.007
Rv1736c.2	2	2oax_SNL_B_2001 PDB CREDO	0.692	0.087	0.528	0.007
Rv1736c.2	2	2x9g_LYA_D_1270 PDB CREDO	0.567	0.221	0.528	0.007
Rv1736c.2	2	1uho_VDN_A_1000 PDB CREDO	0.721	0.066	0.528	0.007
Rv1736c.2	2	1cqe_FLP_B_2650 PDB CREDO	0.751	0.047	0.527	0.007
Rv1736c.2	2	1pxx_DIF_A_701 PDB CREDO	0.751	0.047	0.527	0.007
Rv1736c.2	2	1pxx_DIF_D_3701 PDB CREDO	0.751	0.047	0.527	0.007
Rv1736c.2	2	1udu_CIA_B_2003 PDB CREDO	0.751	0.047	0.527	0.007
Rv1736c.2	2	2oax_SNL_C_3001 PDB CREDO	0.690	0.089	0.527	0.007
Rv1736c.2	2	1q23_FUA_D_705 PDB CREDO	0.565	0.224	0.526	0.007
Rv1736c.2	2	1z9h_IMN_C_379 PDB CREDO	0.749	0.048	0.526	0.007
Rv1736c.2	2	1z9h_IMN_D_476 PDB CREDO	0.749	0.048	0.526	0.007
Rv1736c.2	2	2x9g_LYA_C_1270 PDB CREDO	0.564	0.224	0.526	0.007
Rv1736c.2	2	1q23_FUA_J_711 PDB CREDO	0.604	0.174	0.525	0.007
Rv1736c.2	2	1cqe_FLP_A_1650 PDB CREDO	0.748	0.049	0.525	0.007
Rv1736c.2	2	1xoz_CIA_A_501 PDB CREDO	0.855	0.009	0.525	0.007
Rv1736c.2	2	3vhu_SNL_A_1001 PDB CREDO	0.688	0.090	0.525	0.007
Rv1736c.2	2	2gqg_1N1_A_501 PDB CREDO	0.525	0.281	0.525	0.007
Rv1736c.2	2	1z9h_IMN_A_379 PDB CREDO	0.747	0.050	0.524	0.008
Rv1736c.2	2	1fm6_BRL_D_503 PDB CREDO	0.543	0.254	0.524	0.008
Rv1736c.2	3	1y4l_SVR_B_301 PDB CREDO	0.621	0.155	0.524	0.008
Rv1736c.2	2	2x9g_LYA_A_1270 PDB CREDO	0.664	0.111	0.523	0.008
Rv1736c.2	2	1eqh_FLP_B_1701 PDB CREDO	0.745	0.051	0.523	0.008
Rv1736c.2	2	1q23_FUA_E_706 PDB CREDO	0.601	0.178	0.523	0.008
Rv1736c.2	3	1fm6_BRL_X_504 PDB CREDO	0.722	0.065	0.522	0.008
Rv1736c.2	2	1q23_FUA_K_712 PDB CREDO	0.560	0.231	0.521	0.008
Rv1736c.2	2	1eqh_FLP_A_701 PDB CREDO	0.743	0.052	0.521	0.008
Rv1736c.2	2	1ot7_IU5_B_1002 PDB CREDO	0.606	0.172	0.521	0.008
Rv1736c.2	2	1dtl_BEP_A_205 PDB CREDO	0.682	0.095	0.521	0.008
Rv1736c.2	2	1fko_EFZ_A_999 PDB CREDO	0.711	0.073	0.521	0.008
Rv1736c.2	2	1z9h_IMN_B_381 PDB CREDO	0.742	0.052	0.521	0.008
Rv1736c.2	2	3pgh_FLP_D_701 PDB CREDO	0.742	0.052	0.521	0.008
Rv1736c.2	3	3bjw_SVR_C_505 PDB CREDO	0.535	0.265	0.521	0.008
Rv1736c.2	3	1uwj_BAX_A_1723 PDB CREDO	0.566	0.222	0.521	0.008
Rv1736c.2	2	3lp0_NVP_A_701 PDB CREDO	0.710	0.073	0.520	0.008
Rv1736c.2	3	4asd_BAX_A_1500 PDB CREDO	0.616	0.160	0.519	0.008
Rv1736c.2	2	1q23_FUA_B_703 PDB CREDO	0.595	0.184	0.518	0.008
Rv1736c.2	2	1q23_FUA_L_710 PDB CREDO	0.594	0.187	0.516	0.009
Rv1736c.2	2	3lp1_NVP_A_701 PDB CREDO	0.704	0.078	0.516	0.009
Rv1736c.2	2	4cox_IMN_C_701 PDB CREDO	0.735	0.057	0.516	0.009
Rv1736c.2	2	4cox_IMN_B_701 PDB CREDO	0.734	0.057	0.515	0.009
Rv1736c.2	3	3bjw_SVR_C_507 PDB CREDO	0.544	0.253	0.515	0.009
Rv1736c.2	2	2y00_Y00_A_601 PDB CREDO	0.533	0.268	0.514	0.009
Rv1736c.2	3	3bjw_SVR_A_508 PDB CREDO	0.543	0.254	0.514	0.009
Rv1736c.2	2	1q23_FUA_C_701 PDB CREDO	0.590	0.192	0.513	0.009
Rv1736c.2	3	3nxu_RIT_B_600 PDB CREDO	0.512	0.299	0.512	0.009
Rv1736c.2	2	2zbv_ADN_B_502 PDB CREDO	0.551	0.242	0.512	0.009
Rv1736c.2	2	4cox_IMN_A_701 PDB CREDO	0.730	0.060	0.512	0.009
Rv1736c.2	2	1fm6_BRL_X_504 PDB CREDO	0.647	0.128	0.510	0.009
Rv1736c.2	2	2y00_Y00_B_601 PDB CREDO	0.528	0.276	0.509	0.009
Rv1736c.2	3	3nxu_RIT_A_600 PDB CREDO	0.509	0.304	0.509	0.009
Rv1736c.2	2	2y01_Y00_B_601 PDB CREDO	0.527	0.277	0.509	0.010
Rv1736c.2	2	3erd_DES_A_600 PDB CREDO	0.508	0.305	0.508	0.010
Rv1736c.2	3	3vn2_TLS_A_501 PDB CREDO	0.660	0.115	0.508	0.010
Rv1736c.2	3	1ya4_CTX_A_1 PDB CREDO	0.639	0.135	0.507	0.010
Rv1736c.2	2	3apv_TP0_A_190 PDB CREDO	0.526	0.279	0.507	0.010
Rv1736c.2	2	3oct_1N1_A_663 PDB CREDO	0.544	0.252	0.507	0.010
Rv1736c.2	2	2h77_T3_A_1 PDB CREDO	0.582	0.201	0.507	0.010
Rv1736c.2	2	3gws_T3_X_500 PDB CREDO	0.622	0.154	0.507	0.010
Rv1736c.2	2	2oax_SNL_D_4001 PDB CREDO	0.727	0.061	0.507	0.010
Rv1736c.2	2	2oax_SNL_E_5001 PDB CREDO	0.727	0.061	0.507	0.010
Rv1736c.2	2	2zbv_ADN_C_503 PDB CREDO	0.566	0.222	0.506	0.010
Rv1736c.2	2	2oax_SNL_F_6001 PDB CREDO	0.727	0.062	0.506	0.010
Rv1736c.2	2	3apx_Z80_A_190 PDB CREDO	0.525	0.281	0.506	0.010
Rv1736c.2	2	1bsx_T3_A_1 PDB CREDO	0.620	0.156	0.505	0.010
Rv1736c.2	2	1bsx_T3_B_2 PDB CREDO	0.620	0.156	0.505	0.010
Rv1736c.2	3	2hyy_STI_B_600 PDB CREDO	0.617	0.159	0.505	0.010
Rv1736c.2	2	3apv_TP0_B_190 PDB CREDO	0.586	0.196	0.505	0.010
Rv1736c.2	2	1y0x_T44_X_500 PDB CREDO	0.702	0.079	0.504	0.010
Rv1736c.2	2	2gqg_1N1_B_502 PDB CREDO	0.599	0.181	0.504	0.010
Rv1736c.2	2	1mx1_THA_E_5 PDB CREDO	0.522	0.285	0.503	0.010
Rv1736c.2	2	3u9f_CLM_J_221 PDB CREDO	0.584	0.198	0.503	0.010
Rv1736c.2	3	2h79_T3_A_1 PDB CREDO	0.743	0.052	0.503	0.010
Rv1736c.2	2	1s9p_DES_A_459 PDB CREDO	0.521	0.285	0.503	0.010
Rv1736c.2	2	1zgy_BRL_A_503 PDB CREDO	0.577	0.207	0.502	0.011
Rv1736c.2	2	2y01_Y00_A_601 PDB CREDO	0.502	0.315	0.502	0.011
Rv1736c.2	2	3u9f_CLM_R_221 PDB CREDO	0.583	0.200	0.502	0.011
Rv1736c.2	2	3b0w_DGX_A_1 PDB CREDO	0.742	0.052	0.502	0.011
Rv1736c.2	3	3bjw_SVR_G_506 PDB CREDO	0.528	0.275	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
nitratePubChem	0.919	62.0049
nitrite ionPubChem	0.9	46.0055
nitrous acidPubChem	0.9	46.0055