SInCRe - Rv3883c

Tuberculist information

Gene name	mycP1
Protein function	Membrane-anchored mycosin MycP1 (serine protease) (subtilisin-like protease) (subtilase-like) (mycosin-1)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	4363.42
Molecular mass(da)	45086
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 446

	  		  	1    VHRIFLITVALALLTASPASAITPPPIDPGALPPDVTGPDQPTEQRVLCASPTTLPGSGF   60
			  	61   HDPPWSNTYLGVADAHKFATGAGVTVAVIDTGVDASPRVPAEPGGDFVDQAGNGLSDCDA  120
			  	121  HGTLTASIIAGRPAPTDGFVGVAPDARLLSLRQTSEAFEPVGSQANPNDPNATPAAGSIR  180
			  	181  SLARAVVHAANLGVGVINISEAACYKVSRPIDETSLGASIDYAVNVKGVVVVVAAGNTGG  240
			  	241  DCVQNPAPDPSTPGDPRGWNNVQTVVTPAWYAPLVLSVGGIGQTGMPSSFSMHGPWVDVA  300
			  	301  APAENIVALGDTGEPVNALQGREGPVPIAGTSFAAAYVSGLAALLRQRFPDLTPAQIIHR  360
			  	361  ITATARHPGGGVDDLVGAGVIDAVAALTWDIPPGPASAPYNVRRLPPPVVEPGPDRRPIT  420
			  	421  AVALVAVGLTLALGLGALARRALSRR

Known structures in the PDB

No Known structures

Number of amino acids : 446

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Peptidase_S8	PF00082	85-388

Mtb Structural Proteome models

Model Number	1
Model name	Rv3883c
Template	1GCI APDB CREDO
Template coverage	3_275
Template Identity(%)	32.6
Model coverage(%)	73.1
Normalized DOPE score	-0.779

Model Number	2
Model name	Rv3883c.2
Template	1R6V APDB CREDO
Template coverage	100_452
Template Identity(%)	27.2
Model coverage(%)	83.4
Normalized DOPE score	-0.469

Model Number	3
Model name	Rv3883c.1
Template	1R6V APDB CREDO
Template coverage	91_451
Template Identity(%)	27.1
Model coverage(%)	86.3
Normalized DOPE score	-0.051

Model Number	4
Model name	Rv3883c.3
Template	1P8J APDB CREDO
Template coverage	111_503
Template Identity(%)	17.3
Model coverage(%)	87.7
Normalized DOPE score	0.524

Structure Models from Chopin

Model Number	1
Profile	3.40.50.200 Click for model details
zscore	35.06
Residue begin	6
Residue end	391

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3883c	Gene name	Confidence Score
Rv3882c	eccE1	0.958
Rv3884c	eccA2	0.904

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3883c.3	9	3sm2_478_A_126 PDB CREDO	0.819	0.018	0.661	0.001
Rv3883c.3	1	1y0x_T44_X_500 PDB CREDO	0.685	0.093	0.645	0.001
Rv3883c.3	1	3h52_486_A_3 PDB CREDO	0.685	0.093	0.645	0.001
Rv3883c.2	3	3spk_TPV_A_100 PDB CREDO	0.660	0.114	0.639	0.001
Rv3883c.2	6	3prs_RIT_A_1001 PDB CREDO	0.667	0.109	0.634	0.001
Rv3883c.3	1	3uvv_T3_A_501 PDB CREDO	0.739	0.054	0.634	0.001
Rv3883c.2	3	3bbt_FMM_D_91 PDB CREDO	0.678	0.099	0.634	0.001
Rv3883c.3	1	1xzx_T3_X_500 PDB CREDO	0.737	0.056	0.632	0.001
Rv3883c.3	1	3heg_BAX_A_1 PDB CREDO	0.645	0.129	0.626	0.001
Rv3883c.3	1	2hw2_RFP_A_1200 PDB CREDO	0.707	0.076	0.626	0.001
Rv3883c.2	3	3oez_STI_B_601 PDB CREDO	0.689	0.089	0.625	0.001
Rv3883c.3	1	3b0w_DGX_B_1 PDB CREDO	0.700	0.081	0.624	0.001
Rv3883c.3	1	3gcs_BAX_A_401 PDB CREDO	0.623	0.152	0.623	0.001
Rv3883c.3	1	1bsx_T3_A_1 PDB CREDO	0.750	0.048	0.622	0.001
Rv3883c.3	1	1bsx_T3_B_2 PDB CREDO	0.750	0.048	0.622	0.001
Rv3883c.3	1	2jfa_RAL_B_600 PDB CREDO	0.677	0.099	0.619	0.001
Rv3883c.2	3	3oht_1N1_B_1000 PDB CREDO	0.709	0.074	0.618	0.001
Rv3883c.3	1	3gws_T3_X_500 PDB CREDO	0.744	0.051	0.617	0.002
Rv3883c.3	1	2qxs_RAL_B_600 PDB CREDO	0.728	0.061	0.614	0.002
Rv3883c.3	1	3h52_486_B_1 PDB CREDO	0.632	0.143	0.614	0.002
Rv3883c.3	1	1err_RAL_A_600 PDB CREDO	0.671	0.105	0.612	0.002
Rv3883c.3	1	1err_RAL_B_600 PDB CREDO	0.669	0.106	0.611	0.002
Rv3883c.3	1	2qxs_RAL_A_600 PDB CREDO	0.723	0.064	0.610	0.002
Rv3883c.2	3	2y6o_1N1_A_1892 PDB CREDO	0.650	0.124	0.609	0.002
Rv3883c.2	3	2jfa_RAL_B_600 PDB CREDO	0.690	0.088	0.607	0.002
Rv3883c.2	3	1s9p_DES_A_459 PDB CREDO	0.695	0.084	0.607	0.002
Rv3883c.2	3	2fum_MIX_D_3539 PDB CREDO	0.649	0.126	0.607	0.002
Rv3883c.2	3	1err_RAL_A_600 PDB CREDO	0.689	0.089	0.606	0.002
Rv3883c.2	3	1qkn_RAL_A_600 PDB CREDO	0.625	0.150	0.605	0.002
Rv3883c.2	3	1err_RAL_B_600 PDB CREDO	0.687	0.091	0.604	0.002
Rv3883c.3	1	3h52_486_D_2 PDB CREDO	0.641	0.133	0.604	0.002
Rv3883c.2	6	3pww_ROC_A_1001 PDB CREDO	0.669	0.106	0.603	0.002
Rv3883c.2	3	2jfa_RAL_A_600 PDB CREDO	0.664	0.111	0.603	0.002
Rv3883c.3	1	3cs9_NIL_A_600 PDB CREDO	0.692	0.087	0.600	0.002
Rv3883c.3	1	2oiq_STI_A_1001 PDB CREDO	0.618	0.158	0.600	0.002
Rv3883c.3	1	2w8y_486_A_1000 PDB CREDO	0.598	0.182	0.598	0.002
Rv3883c.2	3	4asd_BAX_A_1500 PDB CREDO	0.739	0.054	0.594	0.002
Rv3883c.3	1	1fm6_BRL_X_504 PDB CREDO	0.692	0.087	0.594	0.002
Rv3883c.3	9	1xkk_FMM_A_91 PDB CREDO	0.769	0.038	0.589	0.003
Rv3883c.2	3	1s9p_DES_D_600 PDB CREDO	0.675	0.101	0.589	0.003
Rv3883c.3	1	2h79_T3_A_1 PDB CREDO	0.733	0.058	0.589	0.003
Rv3883c.3	1	4asd_BAX_A_1500 PDB CREDO	0.586	0.196	0.586	0.003
Rv3883c.2	3	1zgy_BRL_A_503 PDB CREDO	0.606	0.172	0.586	0.003
Rv3883c.2	3	1bsx_T3_A_1 PDB CREDO	0.605	0.173	0.585	0.003
Rv3883c.2	3	1bsx_T3_B_2 PDB CREDO	0.605	0.173	0.585	0.003
Rv3883c.2	3	2oiq_STI_A_1001 PDB CREDO	0.707	0.075	0.585	0.003
Rv3883c.3	1	2h77_T3_A_1 PDB CREDO	0.753	0.046	0.585	0.003
Rv3883c.3	1	3b0w_DGX_A_1 PDB CREDO	0.585	0.197	0.585	0.003
Rv3883c.3	1	3vn2_TLS_A_501 PDB CREDO	0.640	0.135	0.584	0.003
Rv3883c.3	1	3cs9_NIL_B_600 PDB CREDO	0.692	0.087	0.584	0.003
Rv3883c.2	3	1jg2_ADN_A_500 PDB CREDO	0.645	0.129	0.583	0.003
Rv3883c.2	3	3gws_T3_X_500 PDB CREDO	0.602	0.177	0.582	0.003
Rv3883c.2	6	1c6z_ROC_B_505 PDB CREDO	0.595	0.185	0.580	0.003
Rv3883c.2	3	3erd_DES_B_800 PDB CREDO	0.688	0.090	0.579	0.003
Rv3883c.3	1	2jfa_RAL_A_600 PDB CREDO	0.654	0.120	0.579	0.003
Rv3883c.2	3	3heg_BAX_A_1 PDB CREDO	0.699	0.081	0.579	0.003
Rv3883c.2	3	3bbt_FMM_B_91 PDB CREDO	0.769	0.038	0.579	0.003
Rv3883c.2	3	3oht_1N1_A_1000 PDB CREDO	0.740	0.053	0.579	0.003
Rv3883c.2	3	3jwq_VIA_D_901 PDB CREDO	0.617	0.159	0.577	0.003
Rv3883c.2	3	2hw2_RFP_A_1200 PDB CREDO	0.636	0.139	0.577	0.003
Rv3883c.2	3	3erd_DES_A_600 PDB CREDO	0.685	0.093	0.577	0.003
Rv3883c.2	3	3h0a_9RA_A_500 PDB CREDO	0.616	0.160	0.576	0.003
Rv3883c.3	1	1zgy_BRL_A_503 PDB CREDO	0.740	0.054	0.575	0.003
Rv3883c.2	3	2pl0_STI_A_200 PDB CREDO	0.693	0.086	0.573	0.003
Rv3883c.2	3	3v5w_8PR_A_701 PDB CREDO	0.592	0.188	0.573	0.003
Rv3883c.2	3	2hyy_STI_B_600 PDB CREDO	0.691	0.088	0.572	0.003
Rv3883c.3	1	2pl0_STI_A_200 PDB CREDO	0.589	0.193	0.572	0.003
Rv3883c.3	9	3el4_ROC_A_100 PDB CREDO	0.626	0.150	0.570	0.004
Rv3883c.2	3	3uvv_T3_A_501 PDB CREDO	0.609	0.169	0.570	0.004
Rv3883c.2	3	1mx1_THA_C_3 PDB CREDO	0.654	0.121	0.570	0.004
Rv3883c.2	3	3hec_STI_A_1 PDB CREDO	0.627	0.148	0.569	0.004
Rv3883c.2	3	1xzx_T3_X_500 PDB CREDO	0.607	0.171	0.569	0.004
Rv3883c.2	3	2xkw_P1B_B_1475 PDB CREDO	0.676	0.100	0.569	0.004
Rv3883c.2	3	1uwh_BAX_B_1723 PDB CREDO	0.666	0.109	0.568	0.004
Rv3883c.2	3	1uwh_BAX_A_1723 PDB CREDO	0.666	0.110	0.568	0.004
Rv3883c.2	3	2h42_VIA_A_901 PDB CREDO	0.607	0.170	0.568	0.004
Rv3883c.3	9	1c6z_ROC_B_505 PDB CREDO	0.686	0.092	0.567	0.004
Rv3883c.2	3	3oct_1N1_A_663 PDB CREDO	0.627	0.148	0.566	0.004
Rv3883c.2	3	3gcs_BAX_A_401 PDB CREDO	0.704	0.077	0.566	0.004
Rv3883c.2	3	2h79_T3_A_1 PDB CREDO	0.563	0.226	0.563	0.004
Rv3883c.3	1	3gp0_NIL_A_1 PDB CREDO	0.723	0.064	0.563	0.004
Rv3883c.2	3	3spk_TPV_B_100 PDB CREDO	0.721	0.065	0.563	0.004
Rv3883c.3	1	3oez_STI_A_601 PDB CREDO	0.596	0.184	0.562	0.004
Rv3883c.3	1	3spk_TPV_B_100 PDB CREDO	0.577	0.207	0.561	0.004
Rv3883c.3	9	2v0z_C41_C_1328 PDB CREDO	0.694	0.085	0.560	0.004
Rv3883c.3	1	1qkn_RAL_A_600 PDB CREDO	0.675	0.101	0.560	0.004
Rv3883c.2	3	2fum_MIX_A_539 PDB CREDO	0.666	0.110	0.560	0.004
Rv3883c.2	2	3h6t_CYZ_A_265 PDB CREDO	0.559	0.232	0.559	0.004
Rv3883c.2	6	2v0z_C41_C_1328 PDB CREDO	0.559	0.232	0.559	0.004
Rv3883c.2	3	1nhz_486_A_800 PDB CREDO	0.577	0.208	0.558	0.004
Rv3883c.2	3	3k54_1N1_A_1 PDB CREDO	0.687	0.091	0.557	0.004
Rv3883c.2	3	1fm6_BRL_X_504 PDB CREDO	0.595	0.186	0.557	0.004
Rv3883c.2	3	2h77_T3_A_1 PDB CREDO	0.575	0.211	0.556	0.005
Rv3883c.3	1	1n49_RIT_D_401 PDB CREDO	0.589	0.193	0.555	0.005
Rv3883c.3	1	3cs9_NIL_C_600 PDB CREDO	0.694	0.085	0.555	0.005
Rv3883c.3	1	1a28_STR_B_2 PDB CREDO	0.647	0.127	0.555	0.005
Rv3883c.2	6	2v0z_C41_O_1327 PDB CREDO	0.599	0.180	0.554	0.005
Rv3883c.3	1	2xkw_P1B_A_1478 PDB CREDO	0.749	0.048	0.554	0.005
Rv3883c.3	1	2oax_SNL_A_1001 PDB CREDO	0.569	0.218	0.552	0.005
Rv3883c.2	3	1d4s_TPV_A_201 PDB CREDO	0.570	0.217	0.551	0.005
Rv3883c.2	3	2gqg_1N1_A_501 PDB CREDO	0.655	0.119	0.551	0.005
Rv3883c.3	1	2oax_SNL_D_4001 PDB CREDO	0.568	0.219	0.551	0.005
Rv3883c.3	1	2oax_SNL_F_6001 PDB CREDO	0.568	0.219	0.551	0.005
Rv3883c.3	9	3kk6_CEL_A_701 PDB CREDO	0.719	0.067	0.551	0.005
Rv3883c.2	3	1t7j_478_A_200 PDB CREDO	0.646	0.128	0.551	0.005
Rv3883c.3	1	3cs9_NIL_D_600 PDB CREDO	0.689	0.089	0.551	0.005
Rv3883c.2	3	3oez_STI_A_601 PDB CREDO	0.727	0.062	0.551	0.005
Rv3883c.3	1	3qt0_486_A_4 PDB CREDO	0.731	0.059	0.549	0.005
Rv3883c.3	9	2v0z_C41_O_1327 PDB CREDO	0.735	0.057	0.549	0.005
Rv3883c.3	1	1opj_STI_A_3 PDB CREDO	0.633	0.142	0.549	0.005
Rv3883c.3	1	2oax_SNL_E_5001 PDB CREDO	0.565	0.224	0.548	0.005
Rv3883c.2	6	3q70_RIT_A_2001 PDB CREDO	0.783	0.032	0.548	0.005
Rv3883c.3	1	1opj_STI_B_4 PDB CREDO	0.631	0.144	0.547	0.005
Rv3883c.2	3	1mx1_THA_E_5 PDB CREDO	0.674	0.102	0.547	0.005
Rv3883c.2	3	3e22_LOC_B_700 PDB CREDO	0.602	0.176	0.547	0.005
Rv3883c.2	3	3e22_LOC_D_700 PDB CREDO	0.602	0.176	0.547	0.005
Rv3883c.2	3	2aax_PDN_B_503 PDB CREDO	0.546	0.250	0.546	0.005
Rv3883c.2	3	2aa6_STR_B_402 PDB CREDO	0.545	0.251	0.545	0.005
Rv3883c.2	3	3g5d_1N1_B_1 PDB CREDO	0.753	0.046	0.545	0.005
Rv3883c.3	1	2hyy_STI_B_600 PDB CREDO	0.562	0.228	0.545	0.005
Rv3883c.3	1	3h0a_9RA_A_500 PDB CREDO	0.726	0.062	0.545	0.005
Rv3883c.2	6	3el4_ROC_A_100 PDB CREDO	0.616	0.161	0.545	0.005
Rv3883c.3	1	3ln1_CEL_B_682 PDB CREDO	0.656	0.118	0.545	0.005
Rv3883c.2	1	4dta_ADN_A_401 PDB CREDO	0.597	0.183	0.544	0.005
Rv3883c.3	1	1sa1_POD_B_700 PDB CREDO	0.544	0.252	0.544	0.005
Rv3883c.2	3	3qlg_1N1_B_601 PDB CREDO	0.751	0.047	0.544	0.005
Rv3883c.3	9	2pym_1UN_A_1001 PDB CREDO	0.657	0.117	0.544	0.006
Rv3883c.3	1	3ln1_CEL_C_682 PDB CREDO	0.655	0.119	0.544	0.006
Rv3883c.3	9	2q64_1UN_B_1001 PDB CREDO	0.657	0.118	0.544	0.006
Rv3883c.3	1	3ln1_CEL_A_682 PDB CREDO	0.655	0.120	0.543	0.006
Rv3883c.2	3	2aa6_STR_A_401 PDB CREDO	0.543	0.254	0.543	0.006
Rv3883c.2	3	2aax_PDN_A_502 PDB CREDO	0.543	0.254	0.543	0.006
Rv3883c.2	3	2gqg_1N1_B_502 PDB CREDO	0.543	0.254	0.543	0.006
Rv3883c.3	9	2pyn_1UN_A_1001 PDB CREDO	0.656	0.118	0.543	0.006
Rv3883c.2	3	3tne_RIT_A_401 PDB CREDO	0.598	0.182	0.543	0.006
Rv3883c.2	3	3so9_017_A_100 PDB CREDO	0.636	0.139	0.543	0.006
Rv3883c.3	9	2qak_1UN_A_1001 PDB CREDO	0.656	0.119	0.543	0.006
Rv3883c.2	2	1lbc_CYZ_A_330 PDB CREDO	0.571	0.216	0.542	0.006
Rv3883c.2	3	3qlg_1N1_A_601 PDB CREDO	0.748	0.049	0.542	0.006
Rv3883c.3	1	1uob_PNN_A_1311 PDB CREDO	0.558	0.233	0.542	0.006
Rv3883c.2	3	3qt0_486_A_4 PDB CREDO	0.579	0.205	0.542	0.006
Rv3883c.2	3	1a28_STR_B_2 PDB CREDO	0.578	0.207	0.541	0.006
Rv3883c.2	3	1fm6_BRL_D_503 PDB CREDO	0.620	0.156	0.540	0.006
Rv3883c.2	3	3g5d_1N1_A_1 PDB CREDO	0.746	0.050	0.540	0.006
Rv3883c.2	3	1uwj_BAX_B_1723 PDB CREDO	0.672	0.104	0.540	0.006
Rv3883c.3	1	1skx_RFP_A_1 PDB CREDO	0.640	0.134	0.540	0.006
Rv3883c.2	2	3h6t_CYZ_C_265 PDB CREDO	0.568	0.219	0.540	0.006
Rv3883c.3	9	2aof_FRD_C_305 PDB CREDO	0.577	0.208	0.539	0.006
Rv3883c.3	9	2q63_1UN_A_1001 PDB CREDO	0.651	0.124	0.539	0.006
Rv3883c.3	1	1xkk_FMM_A_91 PDB CREDO	0.710	0.073	0.538	0.006
Rv3883c.2	1	2uxp_CLM_B_1211 PDB CREDO	0.564	0.225	0.538	0.006
Rv3883c.2	3	1jg3_ADN_A_500 PDB CREDO	0.663	0.112	0.538	0.006
Rv3883c.2	2	3ijx_HCZ_B_800 PDB CREDO	0.537	0.262	0.537	0.006
Rv3883c.2	3	3mss_STI_A_1 PDB CREDO	0.709	0.074	0.537	0.006
Rv3883c.2	3	2qxs_RAL_B_600 PDB CREDO	0.792	0.028	0.537	0.006
Rv3883c.3	1	3pyy_STI_B_4 PDB CREDO	0.569	0.218	0.537	0.006
Rv3883c.2	3	3rif_IVM_A_403 PDB CREDO	0.638	0.137	0.537	0.006
Rv3883c.3	9	1t46_STI_A_3 PDB CREDO	0.737	0.055	0.537	0.006
Rv3883c.2	3	3h52_486_D_2 PDB CREDO	0.628	0.147	0.536	0.006
Rv3883c.2	3	3k5v_STI_B_2 PDB CREDO	0.707	0.075	0.536	0.006
Rv3883c.3	1	2hyy_STI_D_600 PDB CREDO	0.568	0.219	0.536	0.006
Rv3883c.3	1	1s9p_DES_D_600 PDB CREDO	0.764	0.041	0.535	0.006
Rv3883c.3	1	3erd_DES_B_800 PDB CREDO	0.792	0.028	0.535	0.006
Rv3883c.3	1	3pyy_STI_A_3 PDB CREDO	0.567	0.221	0.535	0.006
Rv3883c.2	3	2zva_1N1_A_513 PDB CREDO	0.768	0.038	0.535	0.006
Rv3883c.3	1	1fm6_BRL_D_503 PDB CREDO	0.763	0.041	0.534	0.006
Rv3883c.2	3	1iep_STI_B_202 PDB CREDO	0.705	0.077	0.534	0.006
Rv3883c.2	3	2hyy_STI_C_600 PDB CREDO	0.705	0.077	0.534	0.006
Rv3883c.2	3	3mss_STI_B_1 PDB CREDO	0.705	0.077	0.534	0.006
Rv3883c.3	1	2hyy_STI_A_600 PDB CREDO	0.566	0.222	0.534	0.006
Rv3883c.3	1	3k5v_STI_B_2 PDB CREDO	0.566	0.222	0.534	0.006
Rv3883c.2	3	3ln1_CEL_D_682 PDB CREDO	0.571	0.215	0.534	0.006
Rv3883c.2	6	3sm2_478_A_126 PDB CREDO	0.534	0.267	0.534	0.006
Rv3883c.3	1	2hyy_STI_C_600 PDB CREDO	0.566	0.222	0.534	0.006
Rv3883c.3	1	3ln1_CEL_D_682 PDB CREDO	0.710	0.073	0.533	0.007
Rv3883c.3	1	3ms9_STI_A_1 PDB CREDO	0.565	0.223	0.533	0.007
Rv3883c.3	1	3ms9_STI_B_1 PDB CREDO	0.565	0.223	0.533	0.007
Rv3883c.2	3	2qxs_RAL_A_600 PDB CREDO	0.787	0.030	0.533	0.007
Rv3883c.2	3	2hyy_STI_A_600 PDB CREDO	0.703	0.078	0.533	0.007
Rv3883c.2	3	1iep_STI_A_201 PDB CREDO	0.703	0.079	0.533	0.007
Rv3883c.2	3	3mss_STI_C_1 PDB CREDO	0.703	0.079	0.533	0.007
Rv3883c.2	3	2prg_BRL_A_1 PDB CREDO	0.610	0.167	0.532	0.007
Rv3883c.2	3	3ms9_STI_A_1 PDB CREDO	0.702	0.079	0.532	0.007
Rv3883c.3	1	3mss_STI_D_1 PDB CREDO	0.564	0.225	0.532	0.007
Rv3883c.2	3	1p93_DEX_C_3999 PDB CREDO	0.550	0.244	0.532	0.007
Rv3883c.2	3	3mss_STI_D_1 PDB CREDO	0.702	0.080	0.532	0.007
Rv3883c.3	1	3gvu_STI_A_1001 PDB CREDO	0.564	0.225	0.532	0.007
Rv3883c.3	1	3mss_STI_A_1 PDB CREDO	0.564	0.225	0.532	0.007
Rv3883c.3	1	3mss_STI_B_1 PDB CREDO	0.564	0.225	0.532	0.007
Rv3883c.2	3	1n49_RIT_D_401 PDB CREDO	0.701	0.080	0.531	0.007
Rv3883c.2	3	2hyy_STI_D_600 PDB CREDO	0.701	0.080	0.531	0.007
Rv3883c.2	3	3h52_486_B_1 PDB CREDO	0.642	0.133	0.531	0.007
Rv3883c.3	1	3mss_STI_C_1 PDB CREDO	0.563	0.226	0.531	0.007
Rv3883c.2	3	1p93_DEX_D_4999 PDB CREDO	0.548	0.247	0.530	0.007
Rv3883c.2	3	3pyy_STI_A_3 PDB CREDO	0.699	0.081	0.530	0.007
Rv3883c.2	3	3gvu_STI_A_1001 PDB CREDO	0.699	0.082	0.530	0.007
Rv3883c.3	1	1iep_STI_B_202 PDB CREDO	0.561	0.228	0.530	0.007
Rv3883c.2	3	1uwj_BAX_A_1723 PDB CREDO	0.719	0.067	0.530	0.007
Rv3883c.3	1	1uwj_BAX_B_1723 PDB CREDO	0.529	0.274	0.529	0.007
Rv3883c.3	1	1iep_STI_A_201 PDB CREDO	0.561	0.229	0.529	0.007
Rv3883c.2	3	1sa1_POD_D_701 PDB CREDO	0.639	0.135	0.529	0.007
Rv3883c.2	3	2q1v_PDN_A_248 PDB CREDO	0.586	0.197	0.529	0.007
Rv3883c.2	3	3ria_IVM_C_349 PDB CREDO	0.629	0.146	0.529	0.007
Rv3883c.3	9	2xkw_P1B_A_1478 PDB CREDO	0.672	0.104	0.529	0.007
Rv3883c.2	3	3ms9_STI_B_1 PDB CREDO	0.698	0.082	0.529	0.007
Rv3883c.2	3	1ya3_STR_A_1001 PDB CREDO	0.585	0.197	0.528	0.007
Rv3883c.2	2	3ilt_TRU_E_800 PDB CREDO	0.555	0.237	0.528	0.007
Rv3883c.3	1	1s9p_DES_A_459 PDB CREDO	0.753	0.046	0.528	0.007
Rv3883c.2	3	3pyy_STI_B_4 PDB CREDO	0.696	0.084	0.528	0.007
Rv3883c.3	9	2nmy_ROC_A_401 PDB CREDO	0.527	0.277	0.527	0.007
Rv3883c.2	3	3ri5_IVM_C_350 PDB CREDO	0.627	0.149	0.527	0.007
Rv3883c.2	6	1c6y_MK1_B_524 PDB CREDO	0.600	0.179	0.527	0.007
Rv3883c.2	3	3rif_IVM_D_402 PDB CREDO	0.626	0.149	0.527	0.007
Rv3883c.2	3	1m2z_DEX_A_301 PDB CREDO	0.544	0.252	0.527	0.007
Rv3883c.3	1	1sa1_POD_D_701 PDB CREDO	0.542	0.255	0.526	0.007
Rv3883c.2	3	1m2z_DEX_D_401 PDB CREDO	0.544	0.253	0.526	0.007
Rv3883c.2	3	3mne_DEX_A_784 PDB CREDO	0.544	0.253	0.526	0.007
Rv3883c.2	3	3ogp_017_A_200 PDB CREDO	0.636	0.139	0.526	0.007
Rv3883c.3	1	3ogp_017_A_200 PDB CREDO	0.542	0.256	0.526	0.007
Rv3883c.2	3	1lhv_NOG_A_301 PDB CREDO	0.561	0.229	0.526	0.007
Rv3883c.3	9	3ndu_ROC_D_100 PDB CREDO	0.538	0.261	0.526	0.007
Rv3883c.2	3	1gs4_ZK5_A_1918 PDB CREDO	0.625	0.151	0.526	0.007
Rv3883c.2	3	3rif_IVM_B_403 PDB CREDO	0.625	0.151	0.526	0.007
Rv3883c.2	3	3rif_IVM_A_402 PDB CREDO	0.624	0.151	0.525	0.007
Rv3883c.3	9	3prs_RIT_A_1001 PDB CREDO	0.619	0.157	0.525	0.007
Rv3883c.3	1	3e22_LOC_B_700 PDB CREDO	0.593	0.188	0.525	0.007
Rv3883c.3	1	3erd_DES_A_600 PDB CREDO	0.776	0.035	0.525	0.007
Rv3883c.2	2	3ik6_HCZ_B_800 PDB CREDO	0.524	0.281	0.524	0.008
Rv3883c.3	1	3e22_LOC_D_700 PDB CREDO	0.592	0.188	0.524	0.008
Rv3883c.2	3	3gn8_DEX_B_247 PDB CREDO	0.542	0.256	0.524	0.008
Rv3883c.2	3	1t46_STI_A_3 PDB CREDO	0.816	0.019	0.524	0.008
Rv3883c.2	1	1uay_ADN_A_1001 PDB CREDO	0.548	0.247	0.523	0.008
Rv3883c.2	1	2uxp_CLM_A_1211 PDB CREDO	0.548	0.247	0.523	0.008
Rv3883c.2	3	3gn8_DEX_A_247 PDB CREDO	0.540	0.258	0.523	0.008
Rv3883c.2	3	1ya3_STR_B_2001 PDB CREDO	0.579	0.205	0.523	0.008
Rv3883c.3	1	2prg_BRL_A_1 PDB CREDO	0.746	0.050	0.523	0.008
Rv3883c.2	3	1y0x_T44_X_500 PDB CREDO	0.613	0.164	0.523	0.008
Rv3883c.3	9	3k4v_ROC_D_201 PDB CREDO	0.560	0.230	0.522	0.008
Rv3883c.2	3	3h52_486_C_4 PDB CREDO	0.621	0.155	0.522	0.008
Rv3883c.3	1	1nhz_486_A_800 PDB CREDO	0.672	0.104	0.522	0.008
Rv3883c.3	1	3k5v_STI_A_2 PDB CREDO	0.586	0.196	0.522	0.008
Rv3883c.2	3	3h52_486_A_3 PDB CREDO	0.611	0.166	0.522	0.008
Rv3883c.2	6	2q64_1UN_B_1001 PDB CREDO	0.535	0.266	0.522	0.008
Rv3883c.3	9	3bjw_SVR_F_502 PDB CREDO	0.680	0.097	0.521	0.008
Rv3883c.2	3	1sa1_POD_B_700 PDB CREDO	0.649	0.126	0.521	0.008
Rv3883c.3	1	3mnp_DEX_A_784 PDB CREDO	0.571	0.216	0.521	0.008
Rv3883c.3	9	3bjw_SVR_H_504 PDB CREDO	0.679	0.098	0.521	0.008
Rv3883c.3	9	2nnk_ROC_A_401 PDB CREDO	0.585	0.198	0.521	0.008
Rv3883c.3	9	3oxc_ROC_A_401 PDB CREDO	0.569	0.218	0.521	0.008
Rv3883c.2	2	2w03_ADN_A_1588 PDB CREDO	0.578	0.207	0.521	0.008
Rv3883c.2	2	3ilt_TRU_B_800 PDB CREDO	0.548	0.247	0.521	0.008
Rv3883c.2	1	2jih_097_A_1001 PDB CREDO	0.603	0.176	0.520	0.008
Rv3883c.3	1	3mno_DEX_A_784 PDB CREDO	0.570	0.217	0.520	0.008
Rv3883c.2	6	2qak_1UN_A_1001 PDB CREDO	0.533	0.268	0.520	0.008
Rv3883c.2	3	3ut5_LOC_D_502 PDB CREDO	0.573	0.213	0.520	0.008
Rv3883c.2	3	1g50_EST_A_600 PDB CREDO	0.776	0.035	0.520	0.008
Rv3883c.3	9	3ndt_ROC_D_100 PDB CREDO	0.584	0.199	0.520	0.008
Rv3883c.3	1	1ya4_CTX_A_1 PDB CREDO	0.776	0.035	0.520	0.008
Rv3883c.2	2	1lbc_CYZ_C_331 PDB CREDO	0.576	0.209	0.519	0.008
Rv3883c.3	1	3kk6_CEL_B_1701 PDB CREDO	0.615	0.161	0.519	0.008
Rv3883c.2	3	2h42_VIA_C_903 PDB CREDO	0.616	0.160	0.519	0.008
Rv3883c.2	6	2pyn_1UN_A_1001 PDB CREDO	0.532	0.270	0.519	0.008
Rv3883c.2	6	1t46_STI_A_3 PDB CREDO	0.575	0.211	0.518	0.008
Rv3883c.3	9	3ufn_ROC_A_401 PDB CREDO	0.693	0.086	0.518	0.008
Rv3883c.2	3	3kw2_ADN_A_300 PDB CREDO	0.662	0.113	0.518	0.008
Rv3883c.2	3	3ln1_CEL_A_682 PDB CREDO	0.535	0.265	0.518	0.008
Rv3883c.2	3	3ln1_CEL_B_682 PDB CREDO	0.535	0.265	0.518	0.008
Rv3883c.2	3	3ln1_CEL_C_682 PDB CREDO	0.535	0.265	0.518	0.008
Rv3883c.2	3	1s9p_DES_B_459 PDB CREDO	0.743	0.052	0.517	0.008
Rv3883c.3	9	1t7i_017_A_200 PDB CREDO	0.567	0.221	0.517	0.008
Rv3883c.3	9	3bjw_SVR_B_501 PDB CREDO	0.674	0.102	0.517	0.008
Rv3883c.2	6	2q63_1UN_A_1001 PDB CREDO	0.530	0.273	0.517	0.008
Rv3883c.3	9	1k6c_MK1_B_902 PDB CREDO	0.567	0.221	0.517	0.008
Rv3883c.3	9	1ya4_CTX_A_1 PDB CREDO	0.594	0.186	0.516	0.009
Rv3883c.2	3	3kw2_ADN_B_300 PDB CREDO	0.740	0.053	0.516	0.009
Rv3883c.3	1	1uwh_BAX_B_1723 PDB CREDO	0.548	0.247	0.516	0.009
Rv3883c.2	6	2pym_1UN_A_1001 PDB CREDO	0.529	0.274	0.516	0.009
Rv3883c.3	1	3ufn_ROC_A_401 PDB CREDO	0.662	0.113	0.516	0.009
Rv3883c.2	3	3ols_EST_A_600 PDB CREDO	0.770	0.037	0.515	0.009
Rv3883c.3	1	1uwj_BAX_A_1723 PDB CREDO	0.562	0.228	0.515	0.009
Rv3883c.3	1	1uwh_BAX_A_1723 PDB CREDO	0.547	0.248	0.515	0.009
Rv3883c.2	3	2prg_BRL_B_2 PDB CREDO	0.590	0.191	0.515	0.009
Rv3883c.3	1	2o4p_TPV_A_300 PDB CREDO	0.530	0.273	0.514	0.009
Rv3883c.2	3	3frq_ERY_B_195 PDB CREDO	0.567	0.221	0.514	0.009
Rv3883c.2	3	2yja_EST_B_1550 PDB CREDO	0.768	0.038	0.514	0.009
Rv3883c.2	2	3ik6_HCZ_B_262 PDB CREDO	0.541	0.256	0.514	0.009
Rv3883c.3	1	3bbt_FMM_D_91 PDB CREDO	0.684	0.093	0.514	0.009
Rv3883c.2	3	1p93_DEX_B_2999 PDB CREDO	0.549	0.245	0.514	0.009
Rv3883c.2	3	3uud_EST_B_600 PDB CREDO	0.767	0.039	0.514	0.009
Rv3883c.3	1	1gs4_ZK5_A_1918 PDB CREDO	0.760	0.043	0.514	0.009
Rv3883c.2	3	3uud_EST_A_600 PDB CREDO	0.767	0.039	0.513	0.009
Rv3883c.3	1	3frq_ERY_A_195 PDB CREDO	0.528	0.275	0.513	0.009
Rv3883c.3	1	3oez_STI_B_601 PDB CREDO	0.579	0.205	0.513	0.009
Rv3883c.2	3	3ols_EST_B_600 PDB CREDO	0.766	0.040	0.513	0.009
Rv3883c.2	3	3k5v_STI_A_2 PDB CREDO	0.715	0.070	0.512	0.009
Rv3883c.2	6	1xkk_FMM_A_91 PDB CREDO	0.539	0.260	0.512	0.009
Rv3883c.2	3	1s9p_DES_C_500 PDB CREDO	0.735	0.057	0.512	0.009
Rv3883c.2	3	2uxo_TAC_B_1211 PDB CREDO	0.765	0.040	0.512	0.009
Rv3883c.3	1	1t46_STI_A_3 PDB CREDO	0.640	0.135	0.511	0.009
Rv3883c.3	9	3gp0_NIL_A_1 PDB CREDO	0.684	0.094	0.511	0.009
Rv3883c.2	3	3adx_IMN_B_3 PDB CREDO	0.763	0.041	0.511	0.009
Rv3883c.2	3	2w8y_486_A_1000 PDB CREDO	0.636	0.139	0.511	0.009
Rv3883c.3	1	3frq_ERY_B_195 PDB CREDO	0.576	0.208	0.510	0.009
Rv3883c.3	1	1n49_RIT_B_301 PDB CREDO	0.588	0.193	0.510	0.009
Rv3883c.2	3	1p93_DEX_A_1999 PDB CREDO	0.545	0.251	0.510	0.009
Rv3883c.2	3	1sqn_NDR_A_1001 PDB CREDO	0.585	0.198	0.510	0.009
Rv3883c.2	3	3jwq_VIA_B_901 PDB CREDO	0.606	0.172	0.510	0.009
Rv3883c.3	1	1d4y_TPV_A_501 PDB CREDO	0.541	0.256	0.510	0.009
Rv3883c.3	1	3bjw_SVR_E_503 PDB CREDO	0.621	0.155	0.510	0.009
Rv3883c.2	1	3ug2_IRE_A_1 PDB CREDO	0.561	0.229	0.509	0.009
Rv3883c.2	3	1kij_NOV_A_400 PDB CREDO	0.545	0.251	0.509	0.009
Rv3883c.2	3	3cs9_NIL_A_600 PDB CREDO	0.731	0.059	0.509	0.009
Rv3883c.3	1	3el0_1UN_A_201 PDB CREDO	0.571	0.215	0.509	0.009
Rv3883c.3	1	2o4n_TPV_A_300 PDB CREDO	0.540	0.258	0.508	0.010
Rv3883c.2	1	3s20_CER_B_1 PDB CREDO	0.533	0.268	0.508	0.010
Rv3883c.3	9	1uwj_BAX_A_1723 PDB CREDO	0.799	0.025	0.507	0.010
Rv3883c.3	9	3bjw_SVR_E_503 PDB CREDO	0.716	0.069	0.507	0.010
Rv3883c.3	9	3cs9_NIL_C_600 PDB CREDO	0.697	0.083	0.507	0.010
Rv3883c.2	6	3el5_1UN_B_201 PDB CREDO	0.507	0.308	0.507	0.010
Rv3883c.2	3	1sqn_NDR_B_2001 PDB CREDO	0.581	0.203	0.507	0.010
Rv3883c.2	3	2aa5_STR_A_301 PDB CREDO	0.507	0.308	0.507	0.010
Rv3883c.3	9	3cs9_NIL_D_600 PDB CREDO	0.696	0.084	0.506	0.010
Rv3883c.2	6	2nni_MTK_A_501 PDB CREDO	0.682	0.095	0.506	0.010
Rv3883c.3	9	2qxs_RAL_A_600 PDB CREDO	0.734	0.057	0.506	0.010
Rv3883c.2	1	3ads_IMN_B_3 PDB CREDO	0.606	0.172	0.506	0.010
Rv3883c.3	9	2qxs_RAL_B_600 PDB CREDO	0.733	0.058	0.506	0.010
Rv3883c.3	1	3sm2_478_A_126 PDB CREDO	0.701	0.080	0.505	0.010
Rv3883c.2	3	3tne_RIT_B_401 PDB CREDO	0.556	0.235	0.505	0.010
Rv3883c.2	3	2aa5_STR_B_302 PDB CREDO	0.505	0.311	0.505	0.010
Rv3883c.3	1	2oax_SNL_C_3001 PDB CREDO	0.570	0.217	0.504	0.010
Rv3883c.2	3	1opj_STI_A_3 PDB CREDO	0.724	0.064	0.504	0.010
Rv3883c.3	1	1p93_DEX_C_3999 PDB CREDO	0.607	0.171	0.504	0.010
Rv3883c.3	1	3ogp_017_B_200 PDB CREDO	0.534	0.266	0.504	0.010
Rv3883c.2	1	2x7h_PFN_A_1372 PDB CREDO	0.504	0.312	0.504	0.010
Rv3883c.2	2	3rf4_FUN_B_202 PDB CREDO	0.504	0.312	0.504	0.010
Rv3883c.2	3	3vn2_TLS_A_501 PDB CREDO	0.573	0.213	0.504	0.010
Rv3883c.2	3	2x9g_LYA_A_1270 PDB CREDO	0.538	0.261	0.504	0.010
Rv3883c.3	1	1p93_DEX_D_4999 PDB CREDO	0.606	0.172	0.503	0.010
Rv3883c.3	1	2ab2_SNL_A_502 PDB CREDO	0.568	0.219	0.503	0.010
Rv3883c.3	1	3mne_DEX_A_784 PDB CREDO	0.606	0.172	0.503	0.010
Rv3883c.2	3	1opj_STI_B_4 PDB CREDO	0.721	0.065	0.502	0.011
Rv3883c.3	1	3vhu_SNL_A_1001 PDB CREDO	0.567	0.220	0.502	0.011
Rv3883c.2	3	3u7s_017_A_201 PDB CREDO	0.519	0.289	0.502	0.011
Rv3883c.3	9	1rl8_RIT_A_9001 PDB CREDO	0.592	0.189	0.502	0.011
Rv3883c.2	1	1sn0_T44_C_601 PDB CREDO	0.550	0.243	0.502	0.011
Rv3883c.3	1	2ab2_SNL_B_503 PDB CREDO	0.567	0.221	0.502	0.011
Rv3883c.3	1	2aoh_FRD_C_305 PDB CREDO	0.517	0.292	0.502	0.011
Rv3883c.3	1	2aoj_FRD_C_305 PDB CREDO	0.517	0.293	0.502	0.011
Rv3883c.2	1	2eva_ADN_A_498 PDB CREDO	0.552	0.241	0.502	0.011
Rv3883c.2	3	1lhu_EST_A_301 PDB CREDO	0.575	0.210	0.502	0.011
Rv3883c.2	3	3d90_NOG_B_2001 PDB CREDO	0.519	0.290	0.502	0.011
Rv3883c.3	1	2oax_SNL_B_2001 PDB CREDO	0.566	0.221	0.501	0.011
Rv3883c.2	2	3ilu_HFZ_B_800 PDB CREDO	0.501	0.316	0.501	0.011
Rv3883c.2	1	4dt8_ADN_A_401 PDB CREDO	0.549	0.245	0.501	0.011
Rv3883c.2	3	2ab2_SNL_B_503 PDB CREDO	0.551	0.242	0.500	0.011
Rv3883c.2	3	1z2b_VLB_C_800 PDB CREDO	0.604	0.174	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
biocytinPubChem	0.9	372.483