Rv3648c

Tuberculist information
Gene namecspA
Protein functionProbable cold shock protein A CspA
Functional category(tuberculist)virulence,detoxification and adaptaion
Gene location(kb)4088.33
Molecular mass(da)7370.2
External sites TB Database TubercuList WebTB
Protein sequence
Number of amino acids : 67
	  		  	1    MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGTGFRTLEENQKVEFEIGHSPKGPQ   60
			  	61   ATGVRSL

Known structures in the PDB
No Known structures
1 7 13 19 25 31 37 43 49 55 61 Range: 2 to 67  |  Coverage: 97% CSD Range: 1 to 66  |  Coverage: 97% 1
Number of amino acids : 67
Domains assigned based on sequence. Mtb Structural proteome models CHOPIN models
Profile-based domain assignment
Structural/Functional domain familyPfam acc.no./SCOP IDDomain Region
CSDPF003132-67
Mtb Structural Proteome models
Model Number1
Model nameRv3648c
Template1CSP    APDBCREDO
Template coverage1_65
Template Identity(%)61.5
Model coverage(%)97.0
Normalized DOPE score-1.647

Structure Models from Chopin
CHOPIN models not available for this query
Binding pockets
STRING
Cytoscape Web will replace the contents of this div with protein-protein interaction network.
Protein interacting with Rv3648cGene nameConfidence Score
Rv3462cinfA0.954
Potential ligand/drug binding sites
No binding sites identified
Similarity to known drug target from sensitive sequence analysis
No drug targets
List of small molecules tested from TIBLE
Data not available
Off-target activity - ligand based from TIBLE
Data not available
Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.
Data not available
STITCH interactions  
No high confidence interactions