SInCRe - Rv2900c

Tuberculist information

Gene name	fdhF
Protein function	Possible formate dehydrogenase H FdhF (formate-hydrogen-lyase-linked, selenocysteine-containing polypeptide) (formate dehydrogenase-H alpha subunit) (FDH-H)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	3209.41
Molecular mass(da)	84566.1
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 779

	  		  	1    MYVEAVRWQRSAASRDVLADYDEQAVTVAPRKREAAGVRAVMVSLQRGMQQMGALRTAAA   60
			  	61   LARLNQRNGFDCPGCAWPEEPGGRKLAEFCENGAKAVAEEATKRTVTAEFFARHSVAELS  120
			  	121  AKPEYWLSQQGRLAHPMVLRPGDDHYRPISWDAAYQLIAEQLNGLDSPDRAVFYTSGRTS  180
			  	181  NEAAFCYQLLVRSFGTNNLPDCSNMCHESSGAALTDSIGIGKGSVTIGDVEHADLIVIAG  240
			  	241  QNPGTNHPRMLSVLGKAKANGAKIIAVNPLPEAGLIRFKDPQKVNGVVGHGIPIADEFVQ  300
			  	301  IRLGGDMALFAGLGRLLLEAEERVPGSVVDRSFVDNHCAGFDGYRRRTLQVGLDTVMDAT  360
			  	361  GIELAQLQRVAAMLMASQRTVICWAMGLTQHAHAVATIGEVTNVLLLRGMIGKPGAGVCP  420
			  	421  VRGHSNVQGDRTMGIWEKMPEQFLAALDREFGITSPRAHGFDTVAAIRAMRDGRVSVFMG  480
			  	481  MGGNFASATPDTAVTEAALRRCALTVQVSTKLNRSHLVHGATALILPTLGRTDRDTRNGR  540
			  	541  KQLVSVEDSMSMVHLSRGSLHPPSDQVRSEVQIICQLARALFGPGHPVPWERFADDYDTI  600
			  	601  RDAIAAVVPGCDDYNHKVRVPDGFQLPHPPRDAREFRTSTGKANFAVNPLQWVPVPPGRL  660
			  	661  VLQTLRSHDQYNTTIYGLDDRYRGVKGGRRVVFINPADIETFGLTAGDRVDLVSEWTDGQ  720
			  	721  GGLQERRAKDFLVVAYSTPVGNAAAYYPETNPLVPLDHTAAQSNTPVSKAIIVRLEPTA

Known structures in the PDB

No Known structures

Number of amino acids : 779

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Molybdopterin	PF00384	132-578
Molydop_binding	PF01568	660-771

Mtb Structural Proteome models

Model Number	1
Model name	Rv2900c
Template	2NAP APDB CREDO
Template coverage	4_723
Template Identity(%)	20.8
Model coverage(%)	89.9
Normalized DOPE score	-0.001

Model Number	2
Model name	Rv2900c.1
Template	1G8K APDB CREDO
Template coverage	4_808
Template Identity(%)	16.9
Model coverage(%)	97.0
Normalized DOPE score	0.666

Structure Models from Chopin

Model Number	1
Profile	c.81.1.1 Click for model details
zscore	37.51
Residue begin	11
Residue end	779

Model Number	2
Profile	3.40.228.10 Click for model details
zscore	22.31
Residue begin	201
Residue end	491

Model Number	3
Profile	3.40.50.740 Click for model details
zscore	11.81
Residue begin	321
Residue end	642

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2900c	Gene name	Confidence Score
Rv2899c	fdhD	0.994
Rv2964	purU	0.935
Rv2964	purU	0.935

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2900c.1	3	1ya3_STR_C_3001 PDB CREDO	0.739	0.054	0.712	0.000
Rv2900c.1	3	1ya3_STR_A_1001 PDB CREDO	0.795	0.026	0.688	0.000
Rv2900c.1	3	1ya3_STR_B_2001 PDB CREDO	0.783	0.032	0.678	0.000
Rv2900c.1	3	3h52_486_C_4 PDB CREDO	0.724	0.064	0.673	0.000
Rv2900c.1	9	2v0z_C41_C_1328 PDB CREDO	0.676	0.100	0.659	0.001
Rv2900c.1	3	2q1v_PDN_A_248 PDB CREDO	0.751	0.047	0.650	0.001
Rv2900c.1	3	1p93_DEX_B_2999 PDB CREDO	0.775	0.035	0.648	0.001
Rv2900c.1	3	2h42_VIA_C_903 PDB CREDO	0.697	0.083	0.648	0.001
Rv2900c.1	3	1a28_STR_A_1 PDB CREDO	0.720	0.067	0.645	0.001
Rv2900c.1	3	1p93_DEX_A_1999 PDB CREDO	0.770	0.037	0.644	0.001
Rv2900c.1	3	2h42_VIA_A_901 PDB CREDO	0.769	0.038	0.643	0.001
Rv2900c.1	3	1nhz_486_A_800 PDB CREDO	0.792	0.028	0.640	0.001
Rv2900c.1	3	2w8y_NDR_B_1000 PDB CREDO	0.715	0.070	0.637	0.001
Rv2900c.1	3	3rhw_IVM_B_349 PDB CREDO	0.661	0.114	0.637	0.001
Rv2900c.1	3	2aa6_STR_A_401 PDB CREDO	0.813	0.020	0.636	0.001
Rv2900c.1	3	3rhw_IVM_B_348 PDB CREDO	0.660	0.115	0.635	0.001
Rv2900c.1	3	3rhw_IVM_D_348 PDB CREDO	0.660	0.115	0.635	0.001
Rv2900c.1	3	3ria_IVM_A_348 PDB CREDO	0.660	0.115	0.635	0.001
Rv2900c.1	9	2v0z_C41_O_1327 PDB CREDO	0.703	0.078	0.635	0.001
Rv2900c.1	3	1sqn_NDR_A_1001 PDB CREDO	0.707	0.075	0.634	0.001
Rv2900c.1	3	2aax_PDN_A_502 PDB CREDO	0.811	0.021	0.634	0.001
Rv2900c.1	3	3rhw_IVM_D_349 PDB CREDO	0.658	0.117	0.634	0.001
Rv2900c.1	3	3ria_IVM_C_350 PDB CREDO	0.658	0.117	0.634	0.001
Rv2900c.1	3	3ria_IVM_E_348 PDB CREDO	0.656	0.119	0.632	0.001
Rv2900c.1	3	2aax_PDN_B_503 PDB CREDO	0.808	0.022	0.632	0.001
Rv2900c.1	3	2aa6_STR_B_402 PDB CREDO	0.807	0.022	0.631	0.001
Rv2900c.1	3	3rif_IVM_E_402 PDB CREDO	0.655	0.120	0.630	0.001
Rv2900c.1	3	3ri5_IVM_B_349 PDB CREDO	0.654	0.121	0.630	0.001
Rv2900c.1	3	3ri5_IVM_D_349 PDB CREDO	0.654	0.121	0.630	0.001
Rv2900c.1	3	3jwq_VIA_B_901 PDB CREDO	0.677	0.099	0.629	0.001
Rv2900c.1	3	3ri5_IVM_C_350 PDB CREDO	0.676	0.100	0.629	0.001
Rv2900c.1	3	3ria_IVM_C_349 PDB CREDO	0.676	0.100	0.629	0.001
Rv2900c.1	3	3rif_IVM_A_402 PDB CREDO	0.675	0.101	0.627	0.001
Rv2900c.1	3	3rif_IVM_B_403 PDB CREDO	0.675	0.101	0.627	0.001
Rv2900c.1	3	3rif_IVM_D_402 PDB CREDO	0.674	0.102	0.627	0.001
Rv2900c.1	3	1sqn_NDR_B_2001 PDB CREDO	0.698	0.082	0.626	0.001
Rv2900c.1	3	3ria_IVM_E_349 PDB CREDO	0.648	0.126	0.624	0.001
Rv2900c.1	3	3rhw_IVM_A_348 PDB CREDO	0.647	0.128	0.623	0.001
Rv2900c.1	3	2h42_VIA_B_902 PDB CREDO	0.668	0.107	0.621	0.001
Rv2900c.1	3	3ri5_IVM_A_349 PDB CREDO	0.642	0.133	0.618	0.002
Rv2900c.1	3	2aa5_STR_B_302 PDB CREDO	0.790	0.029	0.617	0.002
Rv2900c.1	9	3prs_RIT_A_1001 PDB CREDO	0.633	0.142	0.617	0.002
Rv2900c.1	3	3vhu_SNL_A_1001 PDB CREDO	0.867	0.007	0.615	0.002
Rv2900c.1	3	2aa5_STR_A_301 PDB CREDO	0.786	0.030	0.615	0.002
Rv2900c.1	3	3mne_DEX_A_784 PDB CREDO	0.812	0.021	0.614	0.002
Rv2900c.1	3	3rif_IVM_A_403 PDB CREDO	0.658	0.116	0.612	0.002
Rv2900c.1	3	1m2z_DEX_A_301 PDB CREDO	0.808	0.022	0.611	0.002
Rv2900c.1	3	1m2z_DEX_D_401 PDB CREDO	0.808	0.022	0.611	0.002
Rv2900c.1	3	3gn8_DEX_A_247 PDB CREDO	0.807	0.022	0.611	0.002
Rv2900c.1	3	3gn8_DEX_B_247 PDB CREDO	0.806	0.023	0.610	0.002
Rv2900c.1	3	2oax_SNL_B_2001 PDB CREDO	0.859	0.009	0.610	0.002
Rv2900c.1	3	1p93_DEX_D_4999 PDB CREDO	0.803	0.024	0.608	0.002
Rv2900c.1	3	2oax_SNL_C_3001 PDB CREDO	0.854	0.010	0.606	0.002
Rv2900c.1	3	2ab2_SNL_A_502 PDB CREDO	0.853	0.010	0.605	0.002
Rv2900c.1	3	2ab2_SNL_B_503 PDB CREDO	0.852	0.010	0.605	0.002
Rv2900c.1	3	1p93_DEX_C_3999 PDB CREDO	0.799	0.025	0.604	0.002
Rv2900c.1	11	1uob_PNN_A_1311 PDB CREDO	0.678	0.099	0.603	0.002
Rv2900c.1	3	3h0a_9RA_A_500 PDB CREDO	0.719	0.067	0.601	0.002
Rv2900c.1	3	3jwq_VIA_D_901 PDB CREDO	0.719	0.067	0.601	0.002
Rv2900c.1	3	3d90_NOG_B_2001 PDB CREDO	0.743	0.052	0.601	0.002
Rv2900c.1	3	3d90_NOG_A_1001 PDB CREDO	0.742	0.052	0.600	0.002
Rv2900c.1	3	3bbt_FMM_B_91 PDB CREDO	0.623	0.153	0.600	0.002
Rv2900c.1	3	3sxr_1N1_A_1 PDB CREDO	0.666	0.109	0.593	0.002
Rv2900c.1	3	3ls4_TCI_H_220 PDB CREDO	0.665	0.110	0.593	0.002
Rv2900c.1	9	3sm2_478_A_126 PDB CREDO	0.606	0.171	0.591	0.002
Rv2900c.1	3	1gs4_ZK5_A_1918 PDB CREDO	0.636	0.139	0.591	0.002
Rv2900c.1	3	1a27_EST_A_350 PDB CREDO	0.637	0.138	0.590	0.003
Rv2900c.1	3	3ri5_IVM_E_349 PDB CREDO	0.662	0.113	0.590	0.003
Rv2900c.1	9	3pww_ROC_A_1001 PDB CREDO	0.666	0.109	0.586	0.003
Rv2900c.1	3	1s9p_DES_A_459 PDB CREDO	0.652	0.122	0.585	0.003
Rv2900c.1	3	3mno_DEX_A_784 PDB CREDO	0.848	0.011	0.584	0.003
Rv2900c.1	3	3mnp_DEX_A_784 PDB CREDO	0.847	0.011	0.583	0.003
Rv2900c.1	3	1mx1_THA_C_3 PDB CREDO	0.648	0.126	0.581	0.003
Rv2900c.1	3	3adx_IMN_B_3 PDB CREDO	0.679	0.098	0.581	0.003
Rv2900c.1	3	2xpv_MIY_A_1209 PDB CREDO	0.646	0.128	0.580	0.003
Rv2900c.1	3	1a28_STR_B_2 PDB CREDO	0.790	0.029	0.579	0.003
Rv2900c.1	3	3bbt_FMM_D_91 PDB CREDO	0.692	0.087	0.579	0.003
Rv2900c.1	3	3sxr_1N1_B_2 PDB CREDO	0.675	0.101	0.578	0.003
Rv2900c.1	9	3kk6_CEL_A_701 PDB CREDO	0.621	0.155	0.575	0.003
Rv2900c.1	3	1jg3_ADN_A_500 PDB CREDO	0.597	0.183	0.575	0.003
Rv2900c.1	3	1fm6_BRL_D_503 PDB CREDO	0.640	0.134	0.574	0.003
Rv2900c.1	3	3h52_486_D_2 PDB CREDO	0.859	0.009	0.573	0.003
Rv2900c.1	3	2prg_BRL_B_2 PDB CREDO	0.639	0.136	0.573	0.003
Rv2900c.1	3	2oax_SNL_D_4001 PDB CREDO	0.882	0.005	0.571	0.004
Rv2900c.1	11	3bjw_SVR_E_503 PDB CREDO	0.637	0.138	0.570	0.004
Rv2900c.1	3	1mx1_THA_E_5 PDB CREDO	0.590	0.191	0.569	0.004
Rv2900c.1	3	2oax_SNL_A_1001 PDB CREDO	0.879	0.005	0.569	0.004
Rv2900c.1	17	1d4f_ADN_C_603 PDB CREDO	0.569	0.218	0.569	0.004
Rv2900c.1	3	1mx1_THA_F_6 PDB CREDO	0.635	0.139	0.566	0.004
Rv2900c.1	3	2oax_SNL_F_6001 PDB CREDO	0.874	0.006	0.566	0.004
Rv2900c.1	9	3d91_REM_A_350 PDB CREDO	0.804	0.023	0.565	0.004
Rv2900c.1	11	1uwj_BAX_A_1723 PDB CREDO	0.565	0.223	0.565	0.004
Rv2900c.1	3	1lhu_EST_A_301 PDB CREDO	0.629	0.146	0.564	0.004
Rv2900c.1	9	3d91_REM_B_350 PDB CREDO	0.802	0.024	0.564	0.004
Rv2900c.1	3	3aod_RFP_C_2002 PDB CREDO	0.584	0.198	0.563	0.004
Rv2900c.1	3	2oax_SNL_E_5001 PDB CREDO	0.869	0.007	0.563	0.004
Rv2900c.1	3	1mx1_THA_D_4 PDB CREDO	0.631	0.143	0.563	0.004
Rv2900c.1	3	3kw2_ADN_B_300 PDB CREDO	0.631	0.143	0.563	0.004
Rv2900c.1	3	2h77_T3_A_1 PDB CREDO	0.694	0.086	0.561	0.004
Rv2900c.1	3	3k54_1N1_A_1 PDB CREDO	0.580	0.204	0.559	0.004
Rv2900c.1	3	1ya4_CTX_C_3 PDB CREDO	0.626	0.149	0.558	0.004
Rv2900c.1	3	2ayl_FLP_A_1701 PDB CREDO	0.601	0.178	0.557	0.004
Rv2900c.1	3	3h52_486_B_1 PDB CREDO	0.860	0.008	0.557	0.004
Rv2900c.1	17	3n58_ADN_A_500 PDB CREDO	0.556	0.235	0.556	0.005
Rv2900c.1	3	3ln1_CEL_D_682 PDB CREDO	0.665	0.111	0.556	0.005
Rv2900c.1	3	2prg_BRL_A_1 PDB CREDO	0.619	0.157	0.555	0.005
Rv2900c.1	3	1ya4_CTX_B_2 PDB CREDO	0.622	0.154	0.554	0.005
Rv2900c.1	3	1zgy_BRL_A_503 PDB CREDO	0.685	0.093	0.554	0.005
Rv2900c.1	3	1jip_KTN_A_801 PDB CREDO	0.673	0.103	0.553	0.005
Rv2900c.1	3	1jg3_ADN_B_550 PDB CREDO	0.597	0.183	0.553	0.005
Rv2900c.1	3	2h79_T3_A_1 PDB CREDO	0.706	0.076	0.552	0.005
Rv2900c.1	11	3b0w_DGX_B_1 PDB CREDO	0.567	0.220	0.552	0.005
Rv2900c.1	17	1hwi_115_C_4 PDB CREDO	0.570	0.217	0.551	0.005
Rv2900c.1	3	1jg2_ADN_A_500 PDB CREDO	0.635	0.139	0.550	0.005
Rv2900c.1	3	2ito_IRE_A_2020 PDB CREDO	0.568	0.219	0.547	0.005
Rv2900c.1	3	3oht_1N1_A_1000 PDB CREDO	0.546	0.249	0.546	0.005
Rv2900c.1	11	1y0x_T44_X_500 PDB CREDO	0.633	0.142	0.546	0.005
Rv2900c.1	9	1xkk_FMM_A_91 PDB CREDO	0.589	0.192	0.546	0.005
Rv2900c.1	3	3h52_486_A_3 PDB CREDO	0.818	0.019	0.546	0.005
Rv2900c.1	3	3qt0_486_A_4 PDB CREDO	0.650	0.125	0.544	0.006
Rv2900c.1	9	1t46_STI_A_3 PDB CREDO	0.617	0.159	0.543	0.006
Rv2900c.1	3	2xn5_FUN_A_1356 PDB CREDO	0.633	0.141	0.542	0.006
Rv2900c.1	3	3oct_1N1_A_663 PDB CREDO	0.626	0.149	0.542	0.006
Rv2900c.1	12	3ce6_ADN_B_500 PDB CREDO	0.542	0.256	0.542	0.006
Rv2900c.1	3	1lhv_NOG_A_301 PDB CREDO	0.739	0.054	0.541	0.006
Rv2900c.1	11	3bjw_SVR_B_501 PDB CREDO	0.654	0.121	0.541	0.006
Rv2900c.1	12	3ce6_ADN_C_500 PDB CREDO	0.540	0.258	0.540	0.006
Rv2900c.1	11	1hwk_117_B_1 PDB CREDO	0.556	0.236	0.540	0.006
Rv2900c.1	11	3bjw_SVR_F_502 PDB CREDO	0.652	0.122	0.540	0.006
Rv2900c.1	3	1s9p_DES_C_500 PDB CREDO	0.605	0.172	0.539	0.006
Rv2900c.1	3	1s9p_DES_B_459 PDB CREDO	0.605	0.173	0.539	0.006
Rv2900c.1	3	1uho_VDN_A_1000 PDB CREDO	0.683	0.095	0.538	0.006
Rv2900c.1	12	3ce6_ADN_D_500 PDB CREDO	0.538	0.261	0.538	0.006
Rv2900c.1	11	3bjw_SVR_H_504 PDB CREDO	0.649	0.125	0.537	0.006
Rv2900c.1	9	2nni_MTK_A_501 PDB CREDO	0.742	0.052	0.537	0.006
Rv2900c.1	3	2vke_TAC_A_222 PDB CREDO	0.579	0.205	0.537	0.006
Rv2900c.1	17	1hwi_115_A_2 PDB CREDO	0.615	0.161	0.537	0.006
Rv2900c.1	12	3ce6_ADN_A_500 PDB CREDO	0.536	0.264	0.536	0.006
Rv2900c.1	3	1xp0_VDN_A_201 PDB CREDO	0.709	0.074	0.535	0.006
Rv2900c.1	3	3f4x_KLT_A_300 PDB CREDO	0.556	0.236	0.535	0.006
Rv2900c.1	17	4eyb_0WO_A_303 PDB CREDO	0.534	0.266	0.534	0.006
Rv2900c.1	3	1bsx_T3_A_1 PDB CREDO	0.705	0.077	0.534	0.007
Rv2900c.1	3	1bsx_T3_B_2 PDB CREDO	0.705	0.077	0.534	0.007
Rv2900c.1	17	1ynn_RFP_C_1120 PDB CREDO	0.553	0.240	0.533	0.007
Rv2900c.1	12	3n58_ADN_D_500 PDB CREDO	0.533	0.268	0.533	0.007
Rv2900c.1	3	3gws_T3_X_500 PDB CREDO	0.704	0.077	0.533	0.007
Rv2900c.1	9	1uwj_BAX_A_1723 PDB CREDO	0.695	0.085	0.533	0.007
Rv2900c.1	3	2ayl_FLP_B_2701 PDB CREDO	0.648	0.126	0.532	0.007
Rv2900c.1	12	3g1u_ADN_C_438 PDB CREDO	0.532	0.269	0.532	0.007
Rv2900c.1	3	2xpw_OTC_A_222 PDB CREDO	0.574	0.212	0.532	0.007
Rv2900c.1	3	3uvv_T3_A_501 PDB CREDO	0.725	0.063	0.531	0.007
Rv2900c.1	12	3n58_ADN_A_500 PDB CREDO	0.592	0.189	0.531	0.007
Rv2900c.1	3	1mx1_THA_A_1 PDB CREDO	0.673	0.103	0.530	0.007
Rv2900c.1	17	3g1u_ADN_C_438 PDB CREDO	0.590	0.191	0.529	0.007
Rv2900c.1	3	3n8z_FLP_A_701 PDB CREDO	0.549	0.245	0.529	0.007
Rv2900c.1	3	1xzx_T3_X_500 PDB CREDO	0.720	0.066	0.528	0.007
Rv2900c.1	11	1hwk_117_C_4 PDB CREDO	0.575	0.210	0.527	0.007
Rv2900c.1	9	1c6z_ROC_B_505 PDB CREDO	0.527	0.277	0.527	0.007
Rv2900c.1	9	3q70_RIT_A_2001 PDB CREDO	0.772	0.036	0.527	0.007
Rv2900c.1	3	2uxo_TAC_B_1211 PDB CREDO	0.615	0.162	0.526	0.007
Rv2900c.1	17	3ce6_ADN_A_500 PDB CREDO	0.586	0.197	0.525	0.007
Rv2900c.1	17	3ce6_ADN_D_500 PDB CREDO	0.586	0.197	0.525	0.007
Rv2900c.1	3	1jin_KTN_A_801 PDB CREDO	0.588	0.193	0.524	0.008
Rv2900c.1	9	1z2b_VLB_C_800 PDB CREDO	0.768	0.038	0.524	0.008
Rv2900c.1	11	1hwk_117_A_2 PDB CREDO	0.572	0.215	0.524	0.008
Rv2900c.1	3	3b2r_VDN_B_1 PDB CREDO	0.757	0.044	0.523	0.008
Rv2900c.1	3	3erd_DES_A_600 PDB CREDO	0.563	0.226	0.523	0.008
Rv2900c.1	17	1d4f_ADN_D_604 PDB CREDO	0.584	0.199	0.523	0.008
Rv2900c.1	17	3ce6_ADN_B_500 PDB CREDO	0.584	0.199	0.523	0.008
Rv2900c.1	3	3ads_IMN_B_3 PDB CREDO	0.692	0.087	0.523	0.008
Rv2900c.1	3	3b2r_VDN_A_1 PDB CREDO	0.756	0.045	0.523	0.008
Rv2900c.1	12	1d4f_ADN_D_604 PDB CREDO	0.523	0.284	0.523	0.008
Rv2900c.1	17	3ce6_ADN_C_500 PDB CREDO	0.583	0.200	0.523	0.008
Rv2900c.1	3	3nt1_NPS_A_5 PDB CREDO	0.610	0.167	0.522	0.008
Rv2900c.1	11	3frq_ERY_A_195 PDB CREDO	0.552	0.241	0.522	0.008
Rv2900c.1	11	3bjw_SVR_C_505 PDB CREDO	0.582	0.201	0.521	0.008
Rv2900c.1	3	1udu_CIA_B_2003 PDB CREDO	0.690	0.088	0.521	0.008
Rv2900c.1	3	1z9h_IMN_B_381 PDB CREDO	0.690	0.088	0.521	0.008
Rv2900c.1	3	3nt1_NPS_B_4 PDB CREDO	0.609	0.168	0.521	0.008
Rv2900c.1	11	1hwl_FBI_C_4 PDB CREDO	0.586	0.197	0.521	0.008
Rv2900c.1	17	3n58_ADN_D_500 PDB CREDO	0.581	0.203	0.521	0.008
Rv2900c.1	3	1z9h_IMN_A_379 PDB CREDO	0.689	0.089	0.521	0.008
Rv2900c.1	3	1z9h_IMN_C_379 PDB CREDO	0.689	0.089	0.521	0.008
Rv2900c.1	3	1z9h_IMN_D_476 PDB CREDO	0.689	0.089	0.521	0.008
Rv2900c.1	11	1hwl_FBI_A_2 PDB CREDO	0.585	0.198	0.520	0.008
Rv2900c.1	3	1fm6_BRL_X_504 PDB CREDO	0.710	0.073	0.520	0.008
Rv2900c.1	17	2a69_RPT_M_8002 PDB CREDO	0.576	0.208	0.520	0.008
Rv2900c.1	11	3uvv_T3_A_501 PDB CREDO	0.661	0.114	0.520	0.008
Rv2900c.1	11	3kk6_CEL_B_1701 PDB CREDO	0.565	0.224	0.519	0.008
Rv2900c.1	3	2o7o_DXT_A_222 PDB CREDO	0.607	0.171	0.519	0.008
Rv2900c.1	9	1lhv_NOG_A_301 PDB CREDO	0.861	0.008	0.519	0.008
Rv2900c.1	11	1hwl_FBI_B_1 PDB CREDO	0.583	0.199	0.519	0.008
Rv2900c.1	17	1d4f_ADN_B_602 PDB CREDO	0.577	0.207	0.518	0.008
Rv2900c.1	3	2xkw_P1B_B_1475 PDB CREDO	0.557	0.234	0.518	0.008
Rv2900c.1	3	3ln1_CEL_A_682 PDB CREDO	0.683	0.094	0.517	0.008
Rv2900c.1	11	1hwl_FBI_D_3 PDB CREDO	0.581	0.202	0.517	0.008
Rv2900c.1	11	1xzx_T3_X_500 PDB CREDO	0.658	0.117	0.517	0.008
Rv2900c.1	17	1oq5_CEL_A_701 PDB CREDO	0.536	0.264	0.517	0.008
Rv2900c.1	11	3bjw_SVR_B_512 PDB CREDO	0.625	0.151	0.517	0.008
Rv2900c.1	11	3bjw_SVR_A_508 PDB CREDO	0.531	0.272	0.516	0.009
Rv2900c.1	3	2cbr_A80_A_201 PDB CREDO	0.516	0.294	0.516	0.009
Rv2900c.1	3	3ln1_CEL_C_682 PDB CREDO	0.681	0.096	0.516	0.009
Rv2900c.1	3	3e22_LOC_D_700 PDB CREDO	0.726	0.062	0.515	0.009
Rv2900c.1	3	3frq_ERY_B_195 PDB CREDO	0.726	0.062	0.515	0.009
Rv2900c.1	17	3k2h_LYA_B_514 PDB CREDO	0.515	0.295	0.515	0.009
Rv2900c.1	3	3oht_1N1_B_1000 PDB CREDO	0.574	0.212	0.514	0.009
Rv2900c.1	3	1ict_T44_D_129 PDB CREDO	0.577	0.207	0.514	0.009
Rv2900c.1	3	2trt_TAC_A_222 PDB CREDO	0.601	0.178	0.514	0.009
Rv2900c.1	3	3n8z_FLP_B_1701 PDB CREDO	0.601	0.178	0.514	0.009
Rv2900c.1	11	1bsx_T3_B_2 PDB CREDO	0.676	0.101	0.514	0.009
Rv2900c.1	11	1bsx_T3_A_1 PDB CREDO	0.675	0.101	0.514	0.009
Rv2900c.1	11	3gws_T3_X_500 PDB CREDO	0.675	0.101	0.514	0.009
Rv2900c.1	3	3ln1_CEL_B_682 PDB CREDO	0.679	0.098	0.513	0.009
Rv2900c.1	3	3e22_LOC_B_700 PDB CREDO	0.723	0.064	0.513	0.009
Rv2900c.1	11	1uwj_BAX_B_1723 PDB CREDO	0.560	0.231	0.513	0.009
Rv2900c.1	3	1fdu_EST_C_353 PDB CREDO	0.553	0.240	0.512	0.009
Rv2900c.1	3	1s9p_DES_D_600 PDB CREDO	0.571	0.216	0.512	0.009
Rv2900c.1	3	2w9s_TOP_D_1158 PDB CREDO	0.649	0.125	0.512	0.009
Rv2900c.1	3	3tmz_06X_A_503 PDB CREDO	0.677	0.099	0.512	0.009
Rv2900c.1	17	2a69_RPT_C_8001 PDB CREDO	0.570	0.216	0.511	0.009
Rv2900c.1	9	3tkd_CYZ_B_267 PDB CREDO	0.772	0.036	0.511	0.009
Rv2900c.1	11	3bjw_SVR_C_507 PDB CREDO	0.526	0.279	0.511	0.009
Rv2900c.1	12	1d4f_ADN_B_602 PDB CREDO	0.511	0.302	0.511	0.009
Rv2900c.1	17	1hwi_115_B_1 PDB CREDO	0.644	0.130	0.510	0.009
Rv2900c.1	3	3kw2_ADN_A_300 PDB CREDO	0.509	0.304	0.509	0.009
Rv2900c.1	11	3bjw_SVR_G_506 PDB CREDO	0.584	0.199	0.509	0.009
Rv2900c.1	9	1tco_FK5_C_509 PDB CREDO	0.535	0.266	0.508	0.010
Rv2900c.1	3	1mrl_DOL_A_300 PDB CREDO	0.645	0.130	0.508	0.010
Rv2900c.1	9	3bjw_SVR_H_504 PDB CREDO	0.548	0.247	0.508	0.010
Rv2900c.1	3	3uud_EST_A_600 PDB CREDO	0.593	0.188	0.507	0.010
Rv2900c.1	11	2h79_T3_A_1 PDB CREDO	0.688	0.090	0.507	0.010
Rv2900c.1	3	3pgh_FLP_D_701 PDB CREDO	0.671	0.105	0.507	0.010
Rv2900c.1	17	2a68_RBT_C_8001 PDB CREDO	0.525	0.281	0.506	0.010
Rv2900c.1	17	1hwi_115_D_3 PDB CREDO	0.639	0.135	0.506	0.010
Rv2900c.1	9	3bjw_SVR_B_501 PDB CREDO	0.545	0.251	0.505	0.010
Rv2900c.1	17	4e3a_ADN_B_500 PDB CREDO	0.563	0.226	0.505	0.010
Rv2900c.1	3	3q1e_T44_C_128 PDB CREDO	0.524	0.282	0.505	0.010
Rv2900c.1	3	3uud_EST_B_600 PDB CREDO	0.589	0.192	0.505	0.010
Rv2900c.1	3	3nrr_D16_B_520 PDB CREDO	0.583	0.200	0.505	0.010
Rv2900c.1	11	1hwk_117_D_3 PDB CREDO	0.584	0.198	0.504	0.010
Rv2900c.1	3	2gqg_1N1_A_501 PDB CREDO	0.542	0.255	0.504	0.010
Rv2900c.1	3	1g50_EST_A_600 PDB CREDO	0.589	0.193	0.504	0.010
Rv2900c.1	3	2yja_EST_B_1550 PDB CREDO	0.589	0.193	0.504	0.010
Rv2900c.1	9	3bjw_SVR_F_502 PDB CREDO	0.543	0.253	0.504	0.010
Rv2900c.1	9	3kk6_CEL_B_1701 PDB CREDO	0.604	0.174	0.504	0.010
Rv2900c.1	3	1ie4_T44_B_328 PDB CREDO	0.542	0.255	0.502	0.011
Rv2900c.1	9	3tne_RIT_A_401 PDB CREDO	0.806	0.023	0.502	0.011
Rv2900c.1	17	2xpv_MIY_A_1209 PDB CREDO	0.501	0.316	0.501	0.011
Rv2900c.1	17	4eyb_0WO_B_301 PDB CREDO	0.539	0.260	0.501	0.011
Rv2900c.1	3	3vri_1KX_A_301 PDB CREDO	0.562	0.227	0.501	0.011
Rv2900c.1	11	1hwi_115_B_1 PDB CREDO	0.618	0.159	0.501	0.011
Rv2900c.1	12	1hwi_115_C_4 PDB CREDO	0.579	0.206	0.501	0.011
Rv2900c.1	3	1z9y_FUN_A_500 PDB CREDO	0.520	0.288	0.500	0.011
Rv2900c.1	3	2ity_IRE_A_2020 PDB CREDO	0.562	0.228	0.500	0.011
Rv2900c.1	3	3ols_EST_B_600 PDB CREDO	0.584	0.198	0.500	0.011
Rv2900c.1	12	3ond_ADN_A_506 PDB CREDO	0.562	0.228	0.500	0.011
Rv2900c.1	3	3o1c_ADN_A_127 PDB CREDO	0.519	0.289	0.500	0.011
Rv2900c.1	11	1hwi_115_D_3 PDB CREDO	0.617	0.160	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
formatePubChem	0.914	45.0174
carbon dioxidePubChem	0.9	44.0095