SInCRe - Rv2671

Tuberculist information

Gene name	ribD
Protein function	Possible bifunctional enzyme riboflavin biosynthesis protein RibD: diaminohydroxyphosphoribosylaminopyrimidine deaminase (riboflavin-specific deaminase) + 5-amino-6-(5-phosphoribosylamino)uracil reductase (HTP reductase)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	2986.84
Molecular mass(da)	27693.5
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 258

	  		  	1    MPDSGQLGAADTPLRLLSSVHYLTDGELPQLYDYPDDGTWLRANFISSLDGGATVDGTSG   60
			  	61   AMAGPGDRFVFNLLRELADVIVVGVGTVRIEGYSGVRMGVVQRQHRQARGQSEVPQLAIV  120
			  	121  TRSGRLDRDMAVFTRTEMAPLVLTTTAVADDTRQRLAGLAEVIACSGDDPGTVDEAVLVS  180
			  	181  QLAARGLRRILTEGGPTLLGTFVERDVLDELCLTIAPYVVGGLARRIVTGPGQVLTRMRC  240
			  	241  AHVLTDDSGYLYTRYVKT

Known structures in the PDB

No Known structures

Number of amino acids : 258

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
RibD_C	PF01872	39-252

Mtb Structural Proteome models

Model Number	1
Model name	Rv2671.1
Template	2B3Z APDB CREDO
Template coverage	102_359
Template Identity(%)	17.5
Model coverage(%)	99.2
Normalized DOPE score	0.299

Model Number	2
Model name	Rv2671
Template	2B3Z APDB CREDO
Template coverage	154_330
Template Identity(%)	29.4
Model coverage(%)	71.7
Normalized DOPE score	0.338

Structure Models from Chopin

Model Number	1
Profile	c.71.1.2 Click for model details
zscore	29.34
Residue begin	36
Residue end	258

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2671	Gene name	Confidence Score
Rv1415	ribA2	0.976
Rv1415	ribA2	0.976
Rv1409	ribG	0.941
Rv1409	ribG	0.941

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2671.1	3	1xkk_FMM_A_91 PDB CREDO	0.645	0.130	0.628	0.001
Rv2671.1	3	1t46_STI_A_3 PDB CREDO	0.611	0.166	0.595	0.002
Rv2671.1	3	3bjw_SVR_E_503 PDB CREDO	0.607	0.170	0.576	0.003
Rv2671.1	3	1uwj_BAX_A_1723 PDB CREDO	0.672	0.104	0.571	0.004
Rv2671.1	3	3gp0_NIL_A_1 PDB CREDO	0.564	0.224	0.564	0.004
Rv2671.1	3	3bjw_SVR_B_501 PDB CREDO	0.577	0.208	0.562	0.004
Rv2671.1	3	1hwk_117_B_1 PDB CREDO	0.678	0.099	0.559	0.004
Rv2671.1	3	3bjw_SVR_H_504 PDB CREDO	0.571	0.215	0.557	0.004
Rv2671.1	3	3bjw_SVR_F_502 PDB CREDO	0.571	0.216	0.556	0.005
Rv2671.1	3	3sm2_478_A_126 PDB CREDO	0.594	0.186	0.550	0.005
Rv2671.1	3	2xkw_P1B_A_1478 PDB CREDO	0.572	0.214	0.543	0.006
Rv2671.1	3	1hwk_117_A_2 PDB CREDO	0.674	0.102	0.525	0.007
Rv2671.1	3	1uwj_BAX_B_1723 PDB CREDO	0.673	0.103	0.524	0.008
Rv2671.1	3	1hwk_117_C_4 PDB CREDO	0.672	0.104	0.523	0.008
Rv2671.1	3	2v0z_C41_O_1327 PDB CREDO	0.514	0.297	0.514	0.009
Rv2671.1	3	1hwl_FBI_B_1 PDB CREDO	0.678	0.099	0.512	0.009
Rv2671.1	3	1hwl_FBI_D_3 PDB CREDO	0.676	0.101	0.511	0.009
Rv2671.1	3	3b0w_DGX_B_1 PDB CREDO	0.584	0.199	0.510	0.009
Rv2671.1	3	1hwl_FBI_A_2 PDB CREDO	0.669	0.106	0.506	0.010
Rv2671.1	3	1hwl_FBI_C_4 PDB CREDO	0.668	0.107	0.505	0.010
Rv2671.1	3	3kk6_CEL_A_701 PDB CREDO	0.516	0.293	0.503	0.010
Rv2671.1	3	3frq_ERY_A_195 PDB CREDO	0.627	0.148	0.503	0.010
Rv2671.1	3	1sa1_POD_B_700 PDB CREDO	0.645	0.130	0.502	0.011
Rv2671.1	3	1c6z_ROC_B_505 PDB CREDO	0.555	0.237	0.502	0.011
Rv2671.1	3	1uwh_BAX_A_1723 PDB CREDO	0.683	0.094	0.501	0.011
Rv2671.1	3	1uwh_BAX_B_1723 PDB CREDO	0.683	0.095	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
pyrophosphatePubChem	0.9	177.975
H(+)PubChem	0.9	2.01588
C01304PubChem	0.9	353.226
protiumPubChem	0.9	2.01576
deuteriumPubChem	0.9	2.01588
5-amino-6-ribitylamino-2,4(1H,3H)-pyrimidinedionePubChem	0.9	276.247
NADP(H)PubChem	0.9	745.421
formatePubChem	0.9	45.0174
phosphatePubChem	0.9	96.9872
C01268PubChem	0.9	354.211
5-amino-2,6-dioxo-4-ribitylaminopyrimidinePubChem	0.9	276.247
guanosine triphosphatePubChem	0.9	523.18
CPD-1086PubChem	0.9	354.211
NADPPubChem	0.9	744.413
ammoniaPubChem	0.9	17.0305
hydroxyl radicalsPubChem	0.9	17.0073
C04454PubChem	0.9	356.226