SInCRe - Rv2319c

Tuberculist information

Gene name	Rv2319c
Protein function	Universal stress protein family protein
Functional category(tuberculist)	virulence,detoxification and adaptaion
Gene location(kb)	2591.85
Molecular mass(da)	31834.6
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 292

	  		  	1    VTIVVGYLAGKVGPSALHLAVRVARMHKTSLTVATIVRRHWPTPSLARVDAEYELWSEQL   60
			  	61   AAASAREAQRYLRRLADGIEVSYHHRAHRSVSAGLLDVVEELEAEVLVLGSFPSGRRARV  120
			  	121  LIGSTADRLLHSSPVPVAITPRRYRCYTDRLTRLSCGYSATSGSVDVVRRCGHLASRYGV  180
			  	181  PMRVITFAVRGRTMYPPEVGLHAEASVLEAWAAQARELLEKLRINGVVSEDVVLQVVTGN  240
			  	241  GWAQALDAADWQDGEILALGTSPFGDVARVFLGSWSGKIIRYSPVPVLVLPG

Known structures in the PDB

No Known structures

Number of amino acids : 292

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Usp	PF00582	1-141
Usp	PF00582	152-291

Mtb Structural Proteome models

Model Number	1
Model name	Rv2319c.1
Template	1WJG APDB CREDO
Template coverage	4_134
Template Identity(%)	19.1
Model coverage(%)	46.6
Normalized DOPE score	-0.59

Model Number	2
Model name	Rv2319c.2
Template	1WJG APDB CREDO
Template coverage	4_134
Template Identity(%)	19.8
Model coverage(%)	46.6
Normalized DOPE score	-0.367

Model Number	3
Model name	Rv2319c
Template	1WJG APDB CREDO
Template coverage	7_136
Template Identity(%)	23.1
Model coverage(%)	45.9
Normalized DOPE score	-0.156

Structure Models from Chopin

Model Number	1
Profile	c.26.2.4 - 3.40.50.620 Click for model details
zscore	11.23
Residue begin	1
Residue end	154

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2319c	Gene name	Confidence Score
Rv2320c	rocE	0.934

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2319c.2	1	3ri5_IVM_D_349 PDB CREDO	0.591	0.189	0.591	0.002
Rv2319c.2	1	1jg3_ADN_B_550 PDB CREDO	0.614	0.163	0.591	0.002
Rv2319c.2	1	3rif_IVM_E_402 PDB CREDO	0.588	0.194	0.588	0.003
Rv2319c.2	1	3ri5_IVM_B_349 PDB CREDO	0.586	0.196	0.586	0.003
Rv2319c.2	1	3ri5_IVM_A_349 PDB CREDO	0.586	0.197	0.586	0.003
Rv2319c.2	1	3ria_IVM_C_350 PDB CREDO	0.586	0.197	0.586	0.003
Rv2319c.2	1	1jg3_ADN_A_500 PDB CREDO	0.631	0.144	0.585	0.003
Rv2319c.2	1	3rhw_IVM_D_348 PDB CREDO	0.585	0.198	0.585	0.003
Rv2319c.2	1	3rhw_IVM_B_349 PDB CREDO	0.584	0.198	0.584	0.003
Rv2319c.2	1	3rhw_IVM_D_349 PDB CREDO	0.584	0.198	0.584	0.003
Rv2319c.2	1	3rhw_IVM_B_348 PDB CREDO	0.583	0.199	0.583	0.003
Rv2319c.2	1	3ria_IVM_A_348 PDB CREDO	0.583	0.200	0.583	0.003
Rv2319c.2	1	3ria_IVM_E_348 PDB CREDO	0.582	0.201	0.582	0.003
Rv2319c.2	1	3ria_IVM_E_349 PDB CREDO	0.582	0.201	0.582	0.003
Rv2319c.2	1	3sxr_1N1_A_1 PDB CREDO	0.629	0.146	0.582	0.003
Rv2319c.2	1	3rhw_IVM_A_348 PDB CREDO	0.581	0.203	0.581	0.003
Rv2319c.2	1	3bbt_FMM_B_91 PDB CREDO	0.579	0.205	0.579	0.003
Rv2319c.2	1	2uxo_TAC_B_1211 PDB CREDO	0.649	0.125	0.577	0.003
Rv2319c.1	14	2wd9_IBP_A_1570 PDB CREDO	0.571	0.216	0.571	0.004
Rv2319c.2	1	3sxr_1N1_B_2 PDB CREDO	0.642	0.133	0.570	0.004
Rv2319c.2	1	3oht_1N1_A_1000 PDB CREDO	0.591	0.189	0.570	0.004
Rv2319c.2	1	2ity_IRE_A_2020 PDB CREDO	0.614	0.162	0.568	0.004
Rv2319c.2	1	2ito_IRE_A_2020 PDB CREDO	0.567	0.221	0.567	0.004
Rv2319c.2	1	2xn6_T44_A_1370 PDB CREDO	0.638	0.137	0.567	0.004
Rv2319c.2	1	3f4x_KLT_A_300 PDB CREDO	0.565	0.224	0.565	0.004
Rv2319c.2	1	3ri5_IVM_E_349 PDB CREDO	0.610	0.167	0.565	0.004
Rv2319c.2	1	2xn7_T44_A_1355 PDB CREDO	0.633	0.141	0.563	0.004
Rv2319c.2	1	2xn5_FUN_A_1356 PDB CREDO	0.633	0.142	0.562	0.004
Rv2319c.2	1	1ie4_T44_B_328 PDB CREDO	0.581	0.203	0.559	0.004
Rv2319c.2	1	1jg2_ADN_A_500 PDB CREDO	0.665	0.110	0.554	0.005
Rv2319c.2	1	3adx_IMN_B_3 PDB CREDO	0.617	0.159	0.549	0.005
Rv2319c.2	1	3kw2_ADN_B_300 PDB CREDO	0.592	0.188	0.548	0.005
Rv2319c.2	1	3kw2_ADN_A_300 PDB CREDO	0.567	0.220	0.546	0.005
Rv2319c.2	1	3rif_IVM_D_402 PDB CREDO	0.607	0.170	0.544	0.006
Rv2319c.2	1	3rif_IVM_A_402 PDB CREDO	0.607	0.171	0.543	0.006
Rv2319c.2	1	3ri5_IVM_C_350 PDB CREDO	0.606	0.172	0.542	0.006
Rv2319c.1	14	3fre_TOP_X_300 PDB CREDO	0.613	0.164	0.542	0.006
Rv2319c.2	1	3rif_IVM_B_403 PDB CREDO	0.605	0.173	0.542	0.006
Rv2319c.2	1	3bbt_FMM_D_91 PDB CREDO	0.672	0.104	0.541	0.006
Rv2319c.2	1	3ria_IVM_C_349 PDB CREDO	0.604	0.174	0.540	0.006
Rv2319c.2	1	3k54_1N1_A_1 PDB CREDO	0.579	0.205	0.537	0.006
Rv2319c.2	1	3rif_IVM_A_403 PDB CREDO	0.599	0.180	0.536	0.006
Rv2319c.1	16	2wek_DIF_B_1376 PDB CREDO	0.585	0.197	0.536	0.006
Rv2319c.2	1	1ya3_STR_C_3001 PDB CREDO	0.577	0.208	0.535	0.006
Rv2319c.1	14	3a2q_ACA_A_601 PDB CREDO	0.605	0.173	0.535	0.006
Rv2319c.2	1	3fuu_ADN_A_0 PDB CREDO	0.554	0.238	0.533	0.007
Rv2319c.2	1	1ie4_T44_A_128 PDB CREDO	0.621	0.155	0.530	0.007
Rv2319c.2	1	2itz_IRE_A_2021 PDB CREDO	0.596	0.184	0.530	0.007
Rv2319c.1	16	1usq_CLM_F_1144 PDB CREDO	0.580	0.204	0.530	0.007
Rv2319c.2	1	3oht_1N1_B_1000 PDB CREDO	0.612	0.165	0.528	0.007
Rv2319c.2	1	3qlg_1N1_B_601 PDB CREDO	0.548	0.247	0.527	0.007
Rv2319c.1	16	1usq_CLM_D_1142 PDB CREDO	0.576	0.209	0.526	0.007
Rv2319c.1	16	1usq_CLM_E_1143 PDB CREDO	0.576	0.209	0.526	0.007
Rv2319c.1	16	4dtz_LDP_B_501 PDB CREDO	0.526	0.279	0.526	0.007
Rv2319c.2	1	2a69_RPT_C_8001 PDB CREDO	0.545	0.251	0.525	0.007
Rv2319c.2	1	2cbr_A80_A_201 PDB CREDO	0.545	0.251	0.525	0.007
Rv2319c.2	1	3g5d_1N1_A_1 PDB CREDO	0.545	0.251	0.525	0.007
Rv2319c.2	1	3jwq_VIA_B_901 PDB CREDO	0.586	0.197	0.524	0.008
Rv2319c.2	1	1ict_T44_D_129 PDB CREDO	0.566	0.222	0.524	0.008
Rv2319c.2	1	2xpv_MIY_A_1209 PDB CREDO	0.607	0.171	0.524	0.008
Rv2319c.2	1	1ict_T44_C_128 PDB CREDO	0.613	0.164	0.523	0.008
Rv2319c.2	1	1jin_KTN_A_801 PDB CREDO	0.565	0.224	0.522	0.008
Rv2319c.2	1	3qlg_1N1_A_601 PDB CREDO	0.543	0.254	0.522	0.008
Rv2319c.1	16	1usq_CLM_A_1143 PDB CREDO	0.571	0.215	0.522	0.008
Rv2319c.2	1	2riw_T44_A_1395 PDB CREDO	0.636	0.139	0.520	0.008
Rv2319c.2	1	1lhu_EST_A_301 PDB CREDO	0.602	0.177	0.519	0.008
Rv2319c.2	1	2h42_VIA_B_902 PDB CREDO	0.579	0.205	0.518	0.008
Rv2319c.2	1	1jip_KTN_A_801 PDB CREDO	0.607	0.171	0.518	0.008
Rv2319c.2	1	3g5d_1N1_B_1 PDB CREDO	0.538	0.260	0.518	0.008
Rv2319c.1	16	1usq_CLM_B_1143 PDB CREDO	0.567	0.221	0.518	0.008
Rv2319c.1	16	1usq_CLM_C_1143 PDB CREDO	0.567	0.221	0.518	0.008
Rv2319c.2	1	4e3a_ADN_B_500 PDB CREDO	0.537	0.262	0.517	0.008
Rv2319c.2	1	2xkw_P1B_B_1475 PDB CREDO	0.575	0.210	0.515	0.009
Rv2319c.1	14	3jw3_TOP_B_208 PDB CREDO	0.581	0.203	0.513	0.009
Rv2319c.1	16	4du2_LDP_A_501 PDB CREDO	0.609	0.169	0.513	0.009
Rv2319c.2	1	3o1c_ADN_A_127 PDB CREDO	0.551	0.243	0.511	0.009
Rv2319c.2	1	3ads_IMN_B_3 PDB CREDO	0.650	0.124	0.510	0.009
Rv2319c.1	16	2jkj_CLM_E_1141 PDB CREDO	0.558	0.232	0.510	0.009
Rv2319c.1	16	2jkl_CLM_A_1144 PDB CREDO	0.558	0.232	0.510	0.009
Rv2319c.1	16	2jkl_CLM_B_1144 PDB CREDO	0.558	0.232	0.510	0.009
Rv2319c.1	16	2jkl_CLM_D_1145 PDB CREDO	0.558	0.232	0.510	0.009
Rv2319c.2	1	1m17_AQ4_A_999 PDB CREDO	0.596	0.184	0.509	0.010
Rv2319c.2	1	2ceo_T44_A_1395 PDB CREDO	0.677	0.099	0.509	0.010
Rv2319c.2	1	2ceo_T44_B_1395 PDB CREDO	0.677	0.099	0.509	0.010
Rv2319c.2	1	1z9y_FUN_A_500 PDB CREDO	0.508	0.306	0.508	0.010
Rv2319c.2	1	1ya3_STR_B_2001 PDB CREDO	0.608	0.169	0.507	0.010
Rv2319c.2	1	4eb6_VLB_C_503 PDB CREDO	0.565	0.223	0.506	0.010
Rv2319c.2	1	2vke_TAC_A_222 PDB CREDO	0.526	0.279	0.506	0.010
Rv2319c.2	1	3jwq_VIA_D_901 PDB CREDO	0.626	0.149	0.504	0.010
Rv2319c.2	1	3aod_RFP_C_2002 PDB CREDO	0.543	0.254	0.504	0.010
Rv2319c.2	1	3k2h_LYA_A_514 PDB CREDO	0.523	0.283	0.504	0.010
Rv2319c.2	1	1mrl_DOL_A_300 PDB CREDO	0.614	0.162	0.503	0.010
Rv2319c.2	1	2xpw_OTC_A_222 PDB CREDO	0.523	0.284	0.503	0.010
Rv2319c.1	16	2jkj_CLM_F_1143 PDB CREDO	0.550	0.244	0.502	0.011
Rv2319c.1	16	2jkl_CLM_C_1143 PDB CREDO	0.550	0.244	0.502	0.011
Rv2319c.1	16	2jkl_CLM_F_1143 PDB CREDO	0.550	0.244	0.502	0.011
Rv2319c.1	16	3p50_PFL_C_319 PDB CREDO	0.502	0.315	0.502	0.011
Rv2319c.1	14	1fb7_ROC_A_100 PDB CREDO	0.637	0.137	0.502	0.011
Rv2319c.2	1	2o7o_DXT_A_222 PDB CREDO	0.564	0.225	0.501	0.011
Rv2319c.2	1	1oq5_CEL_A_701 PDB CREDO	0.560	0.230	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions