Tuberculist information
Gene nameptpA
Protein functionPhosphotyrosine protein phosphatase PtpA (protein-tyrosine-phosphatase) (PTPase) (LMW phosphatase)
Functional category(tuberculist)regulatory proteins
Gene location(kb)2507.15
Molecular mass(da)17860
External sites TB Database TubercuList WebTB
Protein sequence
Number of amino acids : 163
	  		  	1    VSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAG   60
			  	61   VLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTH  120
			  	121  ALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS
			  			

Known structures in the PDB
PDB ID1U2P
Total residue count163
Number of chains1
MethodX-RAY
Resolution1.9
PDB ID1U2Q
Total residue count163
Number of chains1
MethodX-RAY
Resolution2.5
PDB ID2LUO
Total residue count164
Number of chains1
MethodNMR
ResolutionN/A
Profile-based domain assignment
Structural/Functional domain familyPfam acc.no./SCOP IDDomain Region
LMWPcPF014517-150
Mtb Structural Proteome models
Model Number1
Model nameRv2234_1u2p_A
Template1U2P    APDBCREDO
Template coverage4_159
Template Identity(%)100.0
Model coverage(%)95.1
Normalized DOPE score-2.135

Model Number2
Model nameRv2234
Template1U2P    APDBCREDO
Template coverage4_159
Template Identity(%)100.0
Model coverage(%)95.1
Normalized DOPE score-1.936

Structure Models from Chopin
Model Number1
Profile3.40.50.270
Click for model details
zscore29.14
Residue begin1
Residue end163
Binding pockets
STRING
Cytoscape Web will replace the contents of this div with protein-protein interaction network.
Protein interacting with Rv2234Gene nameConfidence Score
Rv2232ptkA0.977
Rv2235Rv22350.977
Rv2465crpiB0.939
Rv0365cRv0365c0.912
Potential ligand/drug binding sites
Protein ModelPocket NumberDrug Binding Site PMIN ScorePvalue PMINPMAX ScorePvalue PMAX
Rv2234_1u2p_A23s23_CER_A_359PDBCREDO0.6340.1400.5560.004
Similarity to known drug target from sensitive sequence analysis
No drug targets
List of small molecules tested from TIBLE
  View results in TIBLE page
NameAffinityAssay descriptionDOI
CHEMBL1075689Ki = 92.3 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1075731Ki > 100 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1075838Ki = 54.8 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1075857Ki = 22.7 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1075905Ki > 100 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1075973Ki > 100 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1079478Ki = 6 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1079479Ki = 4.9 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1079495Ki = 65.5 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1079660Ki > 100 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1079661Ki > 100 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1079662Ki = 84.4 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1079663Ki > 100 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1079845Ki > 100 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1079988Ki > 100 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1079989Ki > 100 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1080016Ki = 43.1 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1080017Ki = 33 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1080018Ki = 24 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1080200Ki = 44.6 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1080201Ki = 41.8 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1080202Ki = 34.9 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1080311Ki = 18.2 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1080488Ki = 10.7 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1080494Ki = 18.5 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1080495Ki = 16.8 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1080496Ki = 10.3 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1080667Ki = 11.4 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1081059Ki > 100 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1081060Ki > 100 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1081578Ki = 3.3 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1081579Ki = 1.4 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1081583Ki = 75.4 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1081748Ki > 100 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1081935Ki = 72.4 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1081936Ki = 61.6 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1081937Ki = 49.7 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1081955Ki > 100 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1081956Ki = 3.1 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1082128ND(Insoluble)Inhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1082129Ki > 100 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1082130Ki = 68 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1096286Inhibition = 12 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1096287Inhibition = 18 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1098610Inhibition = 39 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1098610IC50 = 93 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1288972Inhibition = 38 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1288972IC50 = 117 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1289338Kb = 3.41 10'4/MBinding affinity to Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by fluorescence quenching assayhttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289338Kb = 3.6 10'4/MBinding affinity to Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by circular dichroism spectral analysishttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289338Ki = 140.2 uMInhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by Lineweaver-Burke plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289456Ki = 36.3 uMInhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by Lineweaver-Burke plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289456Kb = 8.89 10'4/MBinding affinity to Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by fluorescence quenching assayhttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289456Kb = 8.5 10'4/MBinding affinity to Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by circular dichroism spectral analysishttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289457Ki = 85.5 uMInhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by Lineweaver-Burke plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289457Kb = 4.7 10'4/MBinding affinity to Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by circular dichroism spectral analysishttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289457Kb = 4.87 10'4/MBinding affinity to Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by fluorescence quenching assayhttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289563Ki = 215.4 uMInhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by Lineweaver-Burke plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289563Kb = 2.95 10'4/MBinding affinity to Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by circular dichroism spectral analysishttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289563Kb = 2.99 10'4/MBinding affinity to Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by fluorescence quenching assayhttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289564Kb = 1 10'4/MBinding affinity to Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by fluorescence quenching assayhttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289564Kb = 1.1 10'4/MBinding affinity to Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by circular dichroism spectral analysishttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289564Ki = 220.2 uMInhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by Lineweaver-Burke plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289670Kb = 1.2 10'5/MBinding affinity to Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by circular dichroism spectral analysishttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289670Ki = 8 uMInhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by Lineweaver-Burke plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289670Kb = 1.5 10'5/MBinding affinity to Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by fluorescence quenching assayhttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289671Kb = 3.3 10'4/MBinding affinity to Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by circular dichroism spectral analysishttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289671Kb = 3.27 10'4/MBinding affinity to Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by fluorescence quenching assayhttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1289671Ki = 199.1 uMInhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase A by Lineweaver-Burke plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/21050767
CHEMBL1358982Inhibition = 10 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL139856Activity = 80 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL1431701Inhibition = 0 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1499057Inhibition = 5 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL151848Ki > 100 uMInhibition of Mycobacterium tuberculosis PtpAhttp://www.ncbi.nlm.nih.gov/pubmed/19889539
CHEMBL1572512Inhibition = 4 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL160111Inhibition = 10 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1631408Inhibition = 7 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL17200Inhibition = 4 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1765359IC50 = 0.9 uMInhibition of Mycobacterium tuberculosis ptpAhttp://www.ncbi.nlm.nih.gov/pubmed/21420867
CHEMBL1765360Ki = 1.6 uMInhibition of Mycobacterium tuberculosis ptpAhttp://www.ncbi.nlm.nih.gov/pubmed/21420867
CHEMBL1773168IC50 > 50 uMInhibition of Mycobacterium tuberculosis PTPA expressed in Escherichia coli after 5 mins by microplate spectrophotometer analysishttp://www.ncbi.nlm.nih.gov/pubmed/21116447
CHEMBL1773180IC50 > 50 uMInhibition of Mycobacterium tuberculosis PTPA expressed in Escherichia coli after 5 mins by microplate spectrophotometer analysishttp://www.ncbi.nlm.nih.gov/pubmed/21116447
CHEMBL1773181IC50 > 50 uMInhibition of Mycobacterium tuberculosis PTPA expressed in Escherichia coli after 5 mins by microplate spectrophotometer analysishttp://www.ncbi.nlm.nih.gov/pubmed/21116447
CHEMBL1784316IC50 = 110.2 uMNon-competitive inhibition of Mycobacterium tuberculosis PTPA using p-nitrophenyl phosphate as substrate by Lineweaver-Burk plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/21530278
CHEMBL1784316Ki = 22.5 uMNon-competitive inhibition of Mycobacterium tuberculosis PTPA using p-nitrophenyl phosphate as substrate by Lineweaver-Burk plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/21530278
CHEMBL1784317Ki = 101.4 uMNon-competitive inhibition of Mycobacterium tuberculosis PTPA using p-nitrophenyl phosphate as substrate by Lineweaver-Burk plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/21530278
CHEMBL1784317IC50 = 235.6 uMNon-competitive inhibition of Mycobacterium tuberculosis PTPA using p-nitrophenyl phosphate as substrate by Lineweaver-Burk plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/21530278
CHEMBL1851809IC50 = 24.5 uMInhibition of Mycobacterium tuberculosis PTPAhttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL1945174Inhibition = 22 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945175Inhibition = 5 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945176Inhibition = 24 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945177Inhibition = 13 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945178Inhibition = 0 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945179Inhibition = 0 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945180Inhibition = 22 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945181Inhibition = 22 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945182Inhibition = 0 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945183Inhibition = 0 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945184Inhibition = 0 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945185Inhibition = 10 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945186Ki = 12 uMCompetitive inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by Lineweaver-Burk plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945186Inhibition = 40 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945186Ratio = 1.3 NoneRatio of IC50 to Ki for Mycobacterium tuberculosis protein tyrosine phosphatase-Ahttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945186IC50 = 15 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945187Inhibition = 38 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945187IC50 = 102 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945188Inhibition = 12 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945189IC50 = 8.8 uMInhibition of Mycobacterium tuberculosis PTP-Ahttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945543Inhibition = 19 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945544Inhibition = 14 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945545Inhibition = 12 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945546Inhibition = 4 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945547Inhibition = 0 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945548Inhibition = 5 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945549Inhibition = 7 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945550Inhibition = 7 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945551Inhibition = 14 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945552IC50 = 93 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945552Inhibition = 29 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945553Inhibition = 19 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945702IC50 = 101 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945702Inhibition = 42 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945987Inhibition = 13 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945988Inhibition = 16 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945989Inhibition = 0 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945990Inhibition = 8 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945991Inhibition = 10 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945992Inhibition = 7 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945993Inhibition = 13 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945994Inhibition = 8 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945995Inhibition = 15 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945996IC50 = 1023 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945996Inhibition = 30 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945997Inhibition = 49 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945997IC50 = 1659 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945998Inhibition = 19 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945999Inhibition = 43 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1945999IC50 = 331 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946000Inhibition = 21 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946001Inhibition = 10 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946002Inhibition = 9 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946003Inhibition = 9 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946279IC50 = 100 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946279Inhibition = 40 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946280Inhibition = 16 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946281Ki = 23 uMCompetitive inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by Lineweaver-Burk plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946281IC50 = 32 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946281Inhibition = 31 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946281Ratio = 1.4 NoneRatio of IC50 to Ki for Mycobacterium tuberculosis protein tyrosine phosphatase-Ahttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946282IC50 = 302 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946282Inhibition = 63 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946283Inhibition = 5 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946284Inhibition = 23 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946285Inhibition = 35 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946285IC50 = 151 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946286Inhibition = 23 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946287Inhibition = 17 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946288Inhibition = 5 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946289Inhibition = 6 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946436Inhibition = 8 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946437Inhibition = 11 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946438Inhibition = 9 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946439Inhibition = 0 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946440Inhibition = 40 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946440IC50 = 169 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946441Inhibition = 12 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946980Inhibition = 13 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946981Inhibition = 35 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946981IC50 = 74 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946982IC50 = 66 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946982Inhibition = 37 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946983Inhibition = 0 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946984IC50 = 155 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946984Inhibition = 41 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946985Inhibition = 27 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946985IC50 = 407 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946986IC50 = 174 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946986Inhibition = 36 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946987Inhibition = 19 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946988Inhibition = 26 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946988IC50 = 83 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946989Inhibition = 8 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946990Inhibition = 10 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946991Inhibition = 11 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946992Inhibition = 35 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946992IC50 = 93 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946993IC50 = 214 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946993Inhibition = 40 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946994Inhibition = 8 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946995Inhibition = 23 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946996Inhibition = 13 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946997Inhibition = 43 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946997IC50 = 93 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946998IC50 > 100 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL1946998Inhibition = 9 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL200386IC50 > 100 uMInhibitory activity against MPTPAhttp://www.ncbi.nlm.nih.gov/pubmed/16236508
CHEMBL200475IC50 = 74.9 uMInhibitory activity against MPTPAhttp://www.ncbi.nlm.nih.gov/pubmed/16236508
CHEMBL200830IC50 > 100 uMInhibitory activity against MPTPAhttp://www.ncbi.nlm.nih.gov/pubmed/16236508
CHEMBL217931Ki = 4.9 uMInhibition of Mycobacterium tuberculosis PTPA-mediated pNPP hydrolysishttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL217931IC50 = 23.1 uMInhibition of Mycobacterium tuberculosis PTPA after 20 mins by ELISAhttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL217931IC50 = 23.1 uMInhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatasehttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL217931ActiveCompetitive inhibition of Mycobacterium tuberculosis PTPA by Lineweaver-Burke plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL217931Activity = 31.5 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL220818Activity = 109 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL220930Inhibition = 0 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL221741Activity = 82.4 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL227400Activity = 103 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL238634Activity = 91.3 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL244458Activity = 103 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL270117Activity = 99 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL272001Activity = 98 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL275787IC50 = 8.8 uMInhibition of Mycobacterium tuberculosis PTP-Ahttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL276600Activity = 82.4 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL32856Activity = 100 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL32896Activity = 104 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL371922IC50 > 100 uMInhibitory activity against MPTPAhttp://www.ncbi.nlm.nih.gov/pubmed/16236508
CHEMBL372159IC50 > 100 uMInhibitory activity against MPTPAhttp://www.ncbi.nlm.nih.gov/pubmed/16236508
CHEMBL374279Activity = 54 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL374279Ki = 21.3 uMInhibition of Mycobacterium tuberculosis PTPA-mediated pNPP hydrolysishttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL374279IC50 = 39.5 uMInhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatasehttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL374279IC50 = 39.5 uMInhibition of Mycobacterium tuberculosis PTPA after 20 mins by ELISAhttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL374279ActiveCompetitive inhibition of Mycobacterium tuberculosis PTPA by Lineweaver-Burke plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL377360IC50 > 100 uMInhibition of Mycobacterium tuberculosis ptpAhttp://www.ncbi.nlm.nih.gov/pubmed/16884299
CHEMBL381633IC50 > 100 uMInhibitory activity against MPTPAhttp://www.ncbi.nlm.nih.gov/pubmed/16236508
CHEMBL394397Activity = 80 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL404603Inhibition = 0 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL409618IC50 > 100 uMInhibition of Mycobacterium tuberculosis ptpAhttp://www.ncbi.nlm.nih.gov/pubmed/16884299
CHEMBL426212Activity = 102 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL427374IC50 > 100 uMInhibitory activity against MPTPAhttp://www.ncbi.nlm.nih.gov/pubmed/16236508
CHEMBL430187Inhibition = 0 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL439324IC50 > 100 uMInhibition of Mycobacterium tuberculosis ptpAhttp://www.ncbi.nlm.nih.gov/pubmed/16884299
CHEMBL441861IC50 = 8.4 uMInhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatasehttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL441861IC50 = 8.4 uMInhibition of Mycobacterium tuberculosis PTPA after 20 mins by ELISAhttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL441861Activity = 42.5 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL441861Ki = 5.4 uMInhibition of Mycobacterium tuberculosis PTPA-mediated pNPP hydrolysishttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL441861ActiveCompetitive inhibition of Mycobacterium tuberculosis PTPA by Lineweaver-Burke plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL447611Activity = 92 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL449857Activity = 89 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL455453Activity = 80.5 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL455453IC50 = 62 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL455453Inhibition = 33 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL455469Ki = 29 uMCompetitive inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by Lineweaver-Burk plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL455469Ratio = 1.5 NoneRatio of IC50 to Ki for Mycobacterium tuberculosis protein tyrosine phosphatase-Ahttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL455469Inhibition = 26 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL455469Activity = 74 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL455469IC50 = 45 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL484145IC50 = 53.7 uMInhibition of Mycobacterium tuberculosis PTPA after 20 mins by ELISAhttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL484145ActiveCompetitive inhibition of Mycobacterium tuberculosis PTPA by Lineweaver-Burke plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL484145Ki = 17.9 uMInhibition of Mycobacterium tuberculosis PTPA-mediated pNPP hydrolysishttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL487051Dose-dependent effectInhibition of Mycobacterium tuberculosis PTPA-mediated dephosphorylation of VPS33B assessed as increase in phosphorylated VPS33B level after 15 mins by scintillation countinghttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL487051Ki = 9.1 uMInhibition of Mycobacterium tuberculosis PTPA-mediated pNPP hydrolysishttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL487051Activity = 24 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL487051ActiveCompetitive inhibition of Mycobacterium tuberculosis PTPA by Lineweaver-Burke plot analysishttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL487051IC50 = 50.7 uMInhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatasehttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL487051IC50 = 50.2 uMInhibition of Mycobacterium tuberculosis PTPA after 20 mins by ELISAhttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL487052Activity = 82 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL487073Activity = 88 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL487217Activity = 62.7 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL487231Activity = 84.4 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL487232Activity = 84 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL487233Activity = 79.5 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL488058Activity = 88 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL499801Activity = 94 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL506032Activity = 87 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL50626IC50 = 28 uMInhibition of Mycobacterium tuberculosis PTPAhttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CHEMBL507837Activity = 86 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL509013Activity = 99 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL510834Activity = 74.6 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL512571Inhibition = 19 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL519069Activity = 89.2 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL519069Inhibition = 11 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL519069IC50 > 50 uMInhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL520060Activity = 81.5 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL520906IC50 = 53.7 uMInhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatasehttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL520906Activity = 61 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL521380Activity = 75 %Inhibition of Mycobacterium tuberculosis recombinant protein tyrosine phosphatase assessed as enzyme activity at 25 uMhttp://www.ncbi.nlm.nih.gov/pubmed/18930396
CHEMBL595779Inhibition = 5 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL609286Inhibition = 10 %Inhibition of Mycobacterium tuberculosis PTP-A using p-nitrophenyl phosphate as substrate at 25 uM measured for 10 mins by spectrofluorimetryhttp://www.ncbi.nlm.nih.gov/pubmed/22136336
CHEMBL85943IC50 = 30.8 uMInhibition of Mycobacterium tuberculosis PTPAhttp://www.ncbi.nlm.nih.gov/pubmed/20462762
CDD-344419NoneNoneNone
CDD-344447NoneNoneNone
CDD-344562NoneNoneNone
CDD-344619NoneNoneNone
CDD-344747NoneNoneNone
Off-target activity - ligand based from TIBLE
  View results in TIBLE page
Predicted off-targetMethodSummaryFull results
Proto-oncogene tyrosine-protein kinase LCK 2OG8PharmMapper5 hydroph + 5 HB + 1 pos/neg + 0 aromLink
Proto-oncogene tyrosine-protein kinase LCK 2OFVPharmMapper5 hydroph + 4 HB + 0 pos/neg + 0 aromLink
Angiopoietin-1 receptor 2P4IPharmMapper7 hydroph + 2 HB + 0 pos/neg + 0 aromLink
Cellular retinoic acid-binding protein 2 1CBSPharmMapper7 hydroph + 2 HB + 1 pos/neg + 0 aromLink
Aldose reductase 2IKIPharmMapper5 hydroph + 0 HB + 1 pos/neg + 0 aromLink
Protein-tyrosine phosphatase 1B  PASSPa = 0.858 & SM = CHEMBL1081579Link
JAK2 expression  PASSPa = 0.848 & SM = CHEMBL487051Link
formyl peptide receptor; N-formyl-Met-Leu-Phe receptor [-] SEAE_value = 4.06e-35 & MaxTC = 0.6Link
nitric-oxide synthase; inducible [-] SEAE_value = 3.82e-34 & MaxTC = 0.65Link
cysteinyl leukotriene receptor 1; leukotriene D4 receptor SEAE_value = 1.86e-31 & MaxTC = 0.52Link
histone deacetylase 1A [-] SEAE_value = 8.51e-26 & MaxTC = 0.55Link
histone deacetylase 1B [-] SEAE_value = 8.51e-26 & MaxTC = 0.55Link
Nuclear factor NF-kappa-B p100/p49 subunits SEAE_value = 1.23e-18 & MaxTC = 0.53Link
superoxide dismutase [-] SEAE_value = 1.57e-16 & MaxTC = 0.82Link
Nuclear factor NF-kappa-B p105 subunit SEAE_value = 6.49e-16 & MaxTC = 0.53Link
Protein kinase Pfmrk SEAE_value = 2.97e-15 & MaxTC = 0.64Link
prostaglandin H2 synthase [-] SEAE_value = 1.82e-13 & MaxTC = 0.75Link
Glucuronidase (beta) Inhibitor SEAE_value = 2.73e-13 & MaxTC = 0.67Link
histone deacetylase 2 [-] SEAE_value = 1.64e-12 & MaxTC = 0.55Link
Proto-oncogene c-JUN SEAE_value = 9.07e-12 & MaxTC = 0.53Link
Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.
Data not available
STITCH interactions  
Chemical NameConfidence scoreMolecular Weight
phosphatePubChem0.98596.9872
chloridePubChem0.9735.453
glycerolPubChem0.9792.0938
adeninePubChem0.942135.127
p-nitrophenyl phosphatePubChem0.934219.089
hydroxyl radicalsPubChem0.917.0073
HEPESPubChem0.833238.305
2-(N-methyl-N-nitroso)hydroquinonePubChem0.826168.15
sulfatePubChem0.7596.0626
hydron diphosphatePubChem0.74391.981
hydron sulfatePubChem0.734196.157
magnesiumPubChem0.73324.305