SInCRe - Rv2228c

Tuberculist information

Gene name	Rv2228c
Protein function	Multifunctional protein. Has RNASE H, alpha-ribazole phosphatase, and acid phosphatase activities.
Functional category(tuberculist)	information pathways
Gene location(kb)	2501.64
Molecular mass(da)	39113.1
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 364

	  		  	1    VKVVIEADGGSRGNPGPAGYGAVVWTADHSTVLAESKQAIGRATNNVAEYRGLIAGLDDA   60
			  	61   VKLGATEAAVLMDSKLVVEQMSGRWKVKHPDLLKLYVQAQALASQFRRINYEWVPRARNT  120
			  	121  YADRLANDAMDAAAQSAAADADPAKIVATESPTSPGWTGARGTPTRLLLLRHGQTELSEQ  180
			  	181  RRYSGRGNPGLNEVGWRQVGAAAGYLARRGGIAAVVSSPLQRAYDTAVTAARALALDVVV  240
			  	241  DDDLVETDFGAWEGLTFAEAAERDPELHRRWLQDTSITPPGGESFDDVLRRVRRGRDRII  300
			  	301  VGYEGATVLVVSHVTPIKMLLRLALDAGSGVLYRLHLDLASLSIAEFYADGASSVRLVNQ  360
			  	361  TGYL

Known structures in the PDB

	PDB ID	3HST
	Total residue count	1056
	Number of chains	4
	Method	X-RAY
	Resolution	2.25

Number of amino acids : 364

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
RVT_3	PF13456	44-132
His_Phos_1	PF00300	166-320

Mtb Structural Proteome models

Model Number	1
Model name	Rv2228c_3hst_A
Template	3HST APDB CREDO
Template coverage	14_378
Template Identity(%)	100.0
Model coverage(%)	100.0
Normalized DOPE score	-2.332

Model Number	2
Model name	Rv2228c_3hst_C
Template	3HST CPDB CREDO
Template coverage	10_378
Template Identity(%)	100.0
Model coverage(%)	101.1
Normalized DOPE score	-2.246

Model Number	3
Model name	Rv2228c
Template	1K6M APDB CREDO
Template coverage	122_430
Template Identity(%)	24.6
Model coverage(%)	87.1
Normalized DOPE score	1.007

Structure Models from Chopin

Model Number	1
Profile	c.60.1.1 - 3.40.50.1240 Click for model details
zscore	40.57
Residue begin	166
Residue end	320

Model Number	2
Profile	c.60.1.1 - 3.40.50.1240 Click for model details
zscore	21.21
Residue begin	157
Residue end	364

Model Number	3
Profile	c.55.3.1 - 3.30.420.10 Click for model details
zscore	17.07
Residue begin	2
Residue end	139

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2228c	Gene name	Confidence Score
Rv2207	cobT	0.983
Rv2208	cobS	0.943

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2228c_3hst_C	5	3jwq_VIA_B_901 PDB CREDO	0.614	0.163	0.592	0.002
Rv2228c_3hst_C	5	3nrr_D16_B_520 PDB CREDO	0.613	0.164	0.592	0.002
Rv2228c_3hst_C	5	3k2h_LYA_B_514 PDB CREDO	0.591	0.189	0.591	0.002
Rv2228c_3hst_C	5	3ln1_CEL_D_682 PDB CREDO	0.631	0.144	0.589	0.003
Rv2228c_3hst_C	5	4eb6_VLB_C_503 PDB CREDO	0.609	0.168	0.588	0.003
Rv2228c_3hst_A	1	3k2h_LYA_B_514 PDB CREDO	0.584	0.199	0.584	0.003
Rv2228c_3hst_C	5	3adx_IMN_A_2 PDB CREDO	0.603	0.175	0.582	0.003
Rv2228c_3hst_C	5	3ads_IMN_A_2 PDB CREDO	0.602	0.177	0.581	0.003
Rv2228c_3hst_C	5	1fm6_BRL_D_503 PDB CREDO	0.580	0.204	0.580	0.003
Rv2228c_3hst_C	5	2prg_BRL_A_1 PDB CREDO	0.571	0.216	0.571	0.004
Rv2228c_3hst_C	5	3jwq_VIA_D_901 PDB CREDO	0.610	0.168	0.569	0.004
Rv2228c_3hst_C	5	2h42_VIA_B_902 PDB CREDO	0.588	0.194	0.567	0.004
Rv2228c_3hst_C	5	1gs4_ZK5_A_1918 PDB CREDO	0.584	0.198	0.564	0.004
Rv2228c_3hst_C	5	3h0a_9RA_A_500 PDB CREDO	0.604	0.174	0.563	0.004
Rv2228c_3hst_C	5	1a28_STR_A_1 PDB CREDO	0.563	0.227	0.563	0.004
Rv2228c_3hst_C	5	2h42_VIA_C_903 PDB CREDO	0.583	0.200	0.563	0.004
Rv2228c_3hst_A	1	3nrr_D16_B_520 PDB CREDO	0.582	0.201	0.562	0.004
Rv2228c_3hst_C	5	2prg_BRL_B_2 PDB CREDO	0.561	0.228	0.561	0.004
Rv2228c_3hst_A	1	4eb6_VLB_C_503 PDB CREDO	0.581	0.203	0.560	0.004
Rv2228c_3hst_A	1	3jwq_VIA_B_901 PDB CREDO	0.579	0.206	0.558	0.004
Rv2228c_3hst_C	5	3ln1_CEL_C_682 PDB CREDO	0.660	0.114	0.557	0.004
Rv2228c_3hst_C	5	3ln1_CEL_A_682 PDB CREDO	0.660	0.115	0.557	0.004
Rv2228c_3hst_C	5	3oct_1N1_A_663 PDB CREDO	0.575	0.211	0.555	0.005
Rv2228c_3hst_C	5	3ln1_CEL_B_682 PDB CREDO	0.657	0.117	0.555	0.005
Rv2228c_3hst_A	1	3ads_IMN_A_2 PDB CREDO	0.573	0.213	0.553	0.005
Rv2228c_3hst_C	5	2h77_T3_A_1 PDB CREDO	0.612	0.165	0.552	0.005
Rv2228c_3hst_C	5	1sqn_NDR_A_1001 PDB CREDO	0.551	0.243	0.551	0.005
Rv2228c_3hst_C	5	2q1v_PDN_A_248 PDB CREDO	0.570	0.217	0.551	0.005
Rv2228c_3hst_C	5	1cil_ETS_A_263 PDB CREDO	0.589	0.192	0.549	0.005
Rv2228c_3hst_A	1	3adx_IMN_A_2 PDB CREDO	0.568	0.219	0.548	0.005
Rv2228c_3hst_C	5	1p93_DEX_B_2999 PDB CREDO	0.585	0.198	0.545	0.005
Rv2228c_3hst_C	5	3k2h_LYA_A_514 PDB CREDO	0.656	0.119	0.545	0.005
Rv2228c_3hst_C	5	2x9g_LYA_D_1270 PDB CREDO	0.565	0.224	0.545	0.005
Rv2228c_3hst_C	5	1sqn_NDR_B_2001 PDB CREDO	0.543	0.254	0.543	0.006
Rv2228c_3hst_C	5	1s9p_DES_A_459 PDB CREDO	0.543	0.254	0.543	0.006
Rv2228c_3hst_C	5	4eyb_0WO_A_303 PDB CREDO	0.542	0.255	0.542	0.006
Rv2228c_3hst_C	5	3h52_486_C_4 PDB CREDO	0.561	0.229	0.541	0.006
Rv2228c_3hst_C	5	2x9g_LYA_C_1270 PDB CREDO	0.560	0.230	0.541	0.006
Rv2228c_3hst_A	1	1fm6_BRL_D_503 PDB CREDO	0.541	0.257	0.541	0.006
Rv2228c_3hst_C	5	3qt0_486_A_4 PDB CREDO	0.580	0.204	0.541	0.006
Rv2228c_3hst_C	5	3qgz_ADN_A_127 PDB CREDO	0.580	0.203	0.540	0.006
Rv2228c_3hst_A	1	3ln1_CEL_D_682 PDB CREDO	0.578	0.206	0.539	0.006
Rv2228c_3hst_C	5	2h79_T3_A_1 PDB CREDO	0.618	0.158	0.539	0.006
Rv2228c_3hst_C	5	1zgy_BRL_A_503 PDB CREDO	0.597	0.182	0.538	0.006
Rv2228c_3hst_C	5	1ya3_STR_B_2001 PDB CREDO	0.558	0.233	0.538	0.006
Rv2228c_3hst_C	5	1p93_DEX_A_1999 PDB CREDO	0.577	0.208	0.538	0.006
Rv2228c_3hst_C	5	3gws_T3_X_500 PDB CREDO	0.637	0.137	0.538	0.006
Rv2228c_3hst_C	5	3o1c_ADN_A_127 PDB CREDO	0.578	0.207	0.538	0.006
Rv2228c_3hst_A	1	2prg_BRL_A_1 PDB CREDO	0.536	0.263	0.536	0.006
Rv2228c_3hst_C	5	1bsx_T3_A_1 PDB CREDO	0.635	0.139	0.536	0.006
Rv2228c_3hst_C	5	1bsx_T3_B_2 PDB CREDO	0.635	0.139	0.536	0.006
Rv2228c_3hst_C	5	2zbv_ADN_A_501 PDB CREDO	0.576	0.209	0.536	0.006
Rv2228c_3hst_C	5	1ya3_STR_C_3001 PDB CREDO	0.574	0.212	0.534	0.006
Rv2228c_3hst_A	1	1cil_ETS_A_263 PDB CREDO	0.572	0.214	0.534	0.007
Rv2228c_3hst_C	5	3aod_RFP_C_2002 PDB CREDO	0.573	0.213	0.533	0.007
Rv2228c_3hst_C	5	3apv_TP0_A_190 PDB CREDO	0.573	0.213	0.533	0.007
Rv2228c_3hst_C	5	3apx_Z80_A_190 PDB CREDO	0.573	0.213	0.533	0.007
Rv2228c_3hst_C	5	1lhu_EST_A_301 PDB CREDO	0.533	0.269	0.533	0.007
Rv2228c_3hst_C	5	2cbr_A80_A_201 PDB CREDO	0.594	0.186	0.533	0.007
Rv2228c_3hst_A	1	3aod_RFP_C_2002 PDB CREDO	0.572	0.215	0.532	0.007
Rv2228c_3hst_A	1	4eyb_0WO_A_303 PDB CREDO	0.532	0.270	0.532	0.007
Rv2228c_3hst_A	1	3jwq_VIA_D_901 PDB CREDO	0.570	0.217	0.531	0.007
Rv2228c_3hst_C	5	1ya3_STR_A_1001 PDB CREDO	0.550	0.244	0.531	0.007
Rv2228c_3hst_C	5	1fm6_BRL_X_504 PDB CREDO	0.649	0.125	0.530	0.007
Rv2228c_3hst_C	5	4eyb_0WO_B_301 PDB CREDO	0.569	0.218	0.529	0.007
Rv2228c_3hst_A	1	2x9g_LYA_D_1270 PDB CREDO	0.548	0.246	0.529	0.007
Rv2228c_3hst_A	1	3k2h_LYA_A_514 PDB CREDO	0.635	0.140	0.528	0.007
Rv2228c_3hst_C	5	1q23_FUA_I_707 PDB CREDO	0.528	0.276	0.528	0.007
Rv2228c_3hst_A	1	4eyb_0WO_B_301 PDB CREDO	0.566	0.222	0.527	0.007
Rv2228c_3hst_C	5	1xzx_T3_X_500 PDB CREDO	0.643	0.131	0.526	0.007
Rv2228c_3hst_C	5	3uvv_T3_A_501 PDB CREDO	0.643	0.132	0.525	0.007
Rv2228c_3hst_C	5	2h42_VIA_A_901 PDB CREDO	0.563	0.227	0.525	0.007
Rv2228c_3hst_A	1	2h77_T3_A_1 PDB CREDO	0.579	0.205	0.522	0.008
Rv2228c_3hst_A	1	2h42_VIA_B_902 PDB CREDO	0.541	0.257	0.522	0.008
Rv2228c_3hst_A	1	2x9g_LYA_C_1270 PDB CREDO	0.539	0.260	0.520	0.008
Rv2228c_3hst_C	5	2aa6_STR_A_401 PDB CREDO	0.596	0.184	0.520	0.008
Rv2228c_3hst_A	1	3qt0_486_A_4 PDB CREDO	0.557	0.234	0.520	0.008
Rv2228c_3hst_A	1	2prg_BRL_B_2 PDB CREDO	0.519	0.288	0.519	0.008
Rv2228c_3hst_C	5	2gqg_1N1_A_501 PDB CREDO	0.538	0.262	0.519	0.008
Rv2228c_3hst_C	5	2zbv_ADN_B_502 PDB CREDO	0.578	0.206	0.518	0.008
Rv2228c_3hst_C	5	2x9g_LYA_B_1270 PDB CREDO	0.573	0.212	0.517	0.008
Rv2228c_3hst_C	5	2aax_PDN_A_502 PDB CREDO	0.593	0.188	0.517	0.008
Rv2228c_3hst_C	5	4a97_ZPC_J_1318 PDB CREDO	0.536	0.264	0.517	0.008
Rv2228c_3hst_C	5	2aa6_STR_B_402 PDB CREDO	0.592	0.189	0.516	0.009
Rv2228c_3hst_A	1	3ln1_CEL_A_682 PDB CREDO	0.612	0.165	0.516	0.009
Rv2228c_3hst_C	5	3d90_NOG_A_1001 PDB CREDO	0.572	0.214	0.516	0.009
Rv2228c_3hst_C	5	3d90_NOG_B_2001 PDB CREDO	0.572	0.214	0.516	0.009
Rv2228c_3hst_A	1	2cbr_A80_A_201 PDB CREDO	0.575	0.210	0.516	0.009
Rv2228c_3hst_A	1	3apx_Z80_A_190 PDB CREDO	0.554	0.238	0.516	0.009
Rv2228c_3hst_C	5	1a27_EST_A_350 PDB CREDO	0.621	0.155	0.516	0.009
Rv2228c_3hst_C	5	3kw2_ADN_A_300 PDB CREDO	0.575	0.210	0.516	0.009
Rv2228c_3hst_C	5	2aax_PDN_B_503 PDB CREDO	0.591	0.190	0.515	0.009
Rv2228c_3hst_A	1	1gs4_ZK5_A_1918 PDB CREDO	0.534	0.267	0.515	0.009
Rv2228c_3hst_C	5	3o1x_ADN_A_1450 PDB CREDO	0.534	0.267	0.515	0.009
Rv2228c_3hst_C	5	2aa5_STR_B_302 PDB CREDO	0.590	0.192	0.514	0.009
Rv2228c_3hst_A	1	3ln1_CEL_B_682 PDB CREDO	0.609	0.168	0.514	0.009
Rv2228c_3hst_A	1	2h79_T3_A_1 PDB CREDO	0.589	0.192	0.514	0.009
Rv2228c_3hst_C	5	2aa5_STR_A_301 PDB CREDO	0.589	0.192	0.514	0.009
Rv2228c_3hst_A	1	3ln1_CEL_C_682 PDB CREDO	0.608	0.170	0.513	0.009
Rv2228c_3hst_C	5	1nhz_486_A_800 PDB CREDO	0.568	0.220	0.512	0.009
Rv2228c_3hst_A	1	2h42_VIA_C_903 PDB CREDO	0.530	0.273	0.511	0.009
Rv2228c_3hst_C	5	2xpv_MIY_A_1209 PDB CREDO	0.511	0.301	0.511	0.009
Rv2228c_3hst_C	5	3apv_TP0_B_190 PDB CREDO	0.615	0.161	0.511	0.009
Rv2228c_3hst_A	1	3oct_1N1_A_663 PDB CREDO	0.529	0.273	0.511	0.009
Rv2228c_3hst_A	1	3ua1_08Y_A_600 PDB CREDO	0.625	0.150	0.511	0.009
Rv2228c_3hst_A	1	2kce_D16_A_566 PDB CREDO	0.591	0.190	0.510	0.009
Rv2228c_3hst_A	1	3apv_TP0_A_190 PDB CREDO	0.547	0.248	0.509	0.009
Rv2228c_3hst_A	1	1zgy_BRL_A_503 PDB CREDO	0.565	0.224	0.509	0.009
Rv2228c_3hst_C	5	1uob_PNN_A_1311 PDB CREDO	0.705	0.077	0.509	0.010
Rv2228c_3hst_A	1	3o1c_ADN_A_127 PDB CREDO	0.547	0.248	0.509	0.010
Rv2228c_3hst_C	5	1q23_FUA_A_702 PDB CREDO	0.507	0.308	0.507	0.010
Rv2228c_3hst_C	1	2vn1_FK5_A_501 PDB CREDO	0.704	0.077	0.506	0.010
Rv2228c_3hst_C	5	3ua1_08Y_A_600 PDB CREDO	0.619	0.157	0.506	0.010
Rv2228c_3hst_C	1	1fap_RAP_A_108 PDB CREDO	0.666	0.110	0.505	0.010
Rv2228c_3hst_C	5	1z2b_VLB_C_800 PDB CREDO	0.700	0.081	0.505	0.010
Rv2228c_3hst_A	1	3qgz_ADN_A_127 PDB CREDO	0.543	0.254	0.505	0.010
Rv2228c_3hst_C	5	3vn2_TLS_A_501 PDB CREDO	0.658	0.117	0.505	0.010
Rv2228c_3hst_C	5	1p93_DEX_C_3999 PDB CREDO	0.597	0.182	0.504	0.010
Rv2228c_3hst_C	5	1p93_DEX_D_4999 PDB CREDO	0.596	0.183	0.503	0.010
Rv2228c_3hst_A	1	1a28_STR_A_1 PDB CREDO	0.503	0.314	0.503	0.010
Rv2228c_3hst_A	1	3h0a_9RA_A_500 PDB CREDO	0.539	0.260	0.503	0.010
Rv2228c_3hst_C	5	1ki3_PE2_A_1 PDB CREDO	0.629	0.146	0.503	0.011
Rv2228c_3hst_C	5	2ayl_FLP_A_1701 PDB CREDO	0.605	0.173	0.503	0.011
Rv2228c_3hst_A	1	1bsx_T3_A_1 PDB CREDO	0.595	0.185	0.502	0.011
Rv2228c_3hst_A	1	1bsx_T3_B_2 PDB CREDO	0.595	0.185	0.502	0.011
Rv2228c_3hst_A	1	3gws_T3_X_500 PDB CREDO	0.595	0.185	0.502	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
phosphatePubChem	0.913	96.9872
H(+)PubChem	0.9	2.01588
deuteriumPubChem	0.9	2.01588
DMB-ribose-5'-PPubChem	0.9	356.268
3MbpPubChem	0.9	504.437
tartratePubChem	0.9	150.087
polyethylene glycolPubChem	0.9	62.0678
nicotinic acid mononucleotidePubChem	0.9	336.212
(2S,5R)-2-(5,6-dimethylbenzimidazol-1-yl)-5-(hydroxymethyl)oxolane-3,4-diolPubChem	0.9	278.304
alpha-ribazole 5'-phosphatePubChem	0.9	358.284
protiumPubChem	0.9	2.01576
guanylatePubChem	0.9	363.221
adenosylcobinamide-GDPPubChem	0.9	1665.51
cobamide coenzymePubChem	0.9	1579.58
nicotinate mononucleotidePubChem	0.9	335.204
beta-glucanPubChem	0.9	504.437
CHEBI:2479PubChem	0.9	1665.51
nicotinic acidPubChem	0.9	122.101
d-tartratePubChem	0.9	150.087
alpha-ribazolePubChem	0.9	278.304
hydroxyl radicalsPubChem	0.9	17.0073
AdoCblPubChem	0.9	1579.58
5,6-dimethylbenzimidazolePubChem	0.9	146.189
adenosylcobalaminPubChem	0.9	1580.59
ethylene glycol; hydronPubChem	0.9	63.0758