SInCRe - Rv2176

Tuberculist information

Gene name	pknL
Protein function	Probable transmembrane serine/threonine-protein kinase L PknL (protein kinase L) (STPK L)
Functional category(tuberculist)	regulatory proteins
Gene location(kb)	2437.94
Molecular mass(da)	42801.7
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 399

	  		  	1    VVEAGTRDPLESALLDSRYLVQAKIASGGTSTVYRGLDVRLDRPVALKVMDSRYAGDEQF   60
			  	61   LTRFRLEARAVARLNNRALVAVYDQGKDGRHPFLVMELIEGGTLRELLIERGPMPPHAVV  120
			  	121  AVLRPVLGGLAAAHRAGLVHRDVKPENILISDDGDVKLADFGLVRAVAAASITSTGVILG  180
			  	181  TAAYLSPEQVRDGNADPRSDVYSVGVLVYELLTGHTPFTGDSALSIAYQRLDADVPRASA  240
			  	241  VIDGVPPQFDELVACATARNPADRYADAIAMGADLEAIAEELALPEFRVPAPRNSAQHRS  300
			  	301  AALYRSRITQQGQLGAKPVHHPTRQLTRQPGDCSEPASGSEPEHEPITGQFAGIAIEEFI  360
			  	361  WARQHARRMVLVWVSVVLAITGLVASAAWTIGSNLSGLL

Known structures in the PDB

No Known structures

Number of amino acids : 399

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Pkinase	PF00069	19-273

Mtb Structural Proteome models

Model Number	1
Model name	Rv2176
Template	1O6Y APDB CREDO
Template coverage	7_273
Template Identity(%)	45.8
Model coverage(%)	65.2
Normalized DOPE score	-0.684

Model Number	2
Model name	Rv2176.1
Template	1KOB APDB CREDO
Template coverage	33_373
Template Identity(%)	20.8
Model coverage(%)	88.7
Normalized DOPE score	0.039

Structure Models from Chopin

Model Number	1
Profile	d.144.1.7 Click for model details
zscore	20.37
Residue begin	1
Residue end	399

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2176	Gene name	Confidence Score
Rv2175c	Rv2175c	0.988
Rv0018c	pstP	0.972

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2176.1	4	3heg_BAX_A_1 PDB CREDO	0.726	0.062	0.621	0.001
Rv2176.1	1	1hwk_117_B_1 PDB CREDO	0.617	0.160	0.617	0.002
Rv2176.1	4	3gcs_BAX_A_401 PDB CREDO	0.735	0.057	0.610	0.002
Rv2176.1	4	3oez_STI_B_601 PDB CREDO	0.648	0.126	0.608	0.002
Rv2176.1	4	2jfa_RAL_B_600 PDB CREDO	0.655	0.119	0.596	0.002
Rv2176.1	4	3v5w_8PR_A_701 PDB CREDO	0.595	0.184	0.595	0.002
Rv2176.1	2	3oht_1N1_A_1000 PDB CREDO	0.618	0.158	0.595	0.002
Rv2176.1	4	1err_RAL_B_600 PDB CREDO	0.652	0.122	0.593	0.002
Rv2176.1	4	3hec_STI_A_1 PDB CREDO	0.632	0.143	0.593	0.002
Rv2176.1	4	2jfa_RAL_A_600 PDB CREDO	0.631	0.143	0.592	0.002
Rv2176.1	4	1d4s_TPV_A_201 PDB CREDO	0.632	0.143	0.592	0.002
Rv2176.1	4	2o4n_TPV_A_300 PDB CREDO	0.668	0.108	0.589	0.003
Rv2176.1	4	1err_RAL_A_600 PDB CREDO	0.646	0.129	0.587	0.003
Rv2176.1	4	1d4y_TPV_A_501 PDB CREDO	0.664	0.111	0.586	0.003
Rv2176.1	4	2oiq_STI_A_1001 PDB CREDO	0.684	0.093	0.585	0.003
Rv2176.1	1	1hwk_117_A_2 PDB CREDO	0.612	0.164	0.578	0.003
Rv2176.1	1	1hwk_117_C_4 PDB CREDO	0.612	0.165	0.577	0.003
Rv2176.1	4	1qkn_RAL_A_600 PDB CREDO	0.574	0.212	0.574	0.003
Rv2176.1	2	3r9c_ECL_A_452 PDB CREDO	0.697	0.083	0.570	0.004
Rv2176.1	1	1hwl_FBI_B_1 PDB CREDO	0.623	0.153	0.570	0.004
Rv2176.1	1	1hwl_FBI_D_3 PDB CREDO	0.622	0.153	0.570	0.004
Rv2176.1	4	2pl0_STI_A_200 PDB CREDO	0.665	0.110	0.569	0.004
Rv2176.1	4	2hyy_STI_B_600 PDB CREDO	0.664	0.111	0.568	0.004
Rv2176.1	2	2xkw_P1B_B_1475 PDB CREDO	0.631	0.144	0.565	0.004
Rv2176.1	17	3hec_STI_A_1 PDB CREDO	0.581	0.202	0.563	0.004
Rv2176.1	1	1uwj_BAX_A_1723 PDB CREDO	0.580	0.204	0.563	0.004
Rv2176.1	2	3cs8_BRL_A_503 PDB CREDO	0.609	0.169	0.563	0.004
Rv2176.1	2	3oht_1N1_B_1000 PDB CREDO	0.651	0.124	0.562	0.004
Rv2176.1	1	1hwl_FBI_C_4 PDB CREDO	0.614	0.163	0.562	0.004
Rv2176.1	1	1hwl_FBI_A_2 PDB CREDO	0.612	0.165	0.560	0.004
Rv2176.1	1	1hwk_117_D_3 PDB CREDO	0.626	0.150	0.556	0.005
Rv2176.1	1	2nni_MTK_A_501 PDB CREDO	0.571	0.215	0.555	0.005
Rv2176.1	4	3oez_STI_A_601 PDB CREDO	0.707	0.076	0.553	0.005
Rv2176.1	2	3g5d_1N1_B_1 PDB CREDO	0.573	0.213	0.552	0.005
Rv2176.1	4	2o4p_TPV_A_300 PDB CREDO	0.683	0.094	0.551	0.005
Rv2176.1	2	3lfa_1N1_A_361 PDB CREDO	0.670	0.105	0.549	0.005
Rv2176.1	4	3u7s_017_A_202 PDB CREDO	0.565	0.223	0.547	0.005
Rv2176.1	2	1sn5_T3_C_601 PDB CREDO	0.668	0.107	0.547	0.005
Rv2176.1	2	3g5d_1N1_A_1 PDB CREDO	0.569	0.219	0.547	0.005
Rv2176.1	4	3erd_DES_B_800 PDB CREDO	0.669	0.106	0.545	0.005
Rv2176.1	2	3qlg_1N1_A_601 PDB CREDO	0.566	0.222	0.545	0.005
Rv2176.1	1	3frq_ERY_A_195 PDB CREDO	0.561	0.229	0.545	0.005
Rv2176.1	2	3qlg_1N1_B_601 PDB CREDO	0.563	0.226	0.542	0.006
Rv2176.1	17	3oez_STI_B_601 PDB CREDO	0.558	0.233	0.541	0.006
Rv2176.1	4	4asd_BAX_A_1500 PDB CREDO	0.651	0.123	0.540	0.006
Rv2176.1	2	2cbr_A80_A_201 PDB CREDO	0.560	0.230	0.539	0.006
Rv2176.1	4	3ogp_017_A_200 PDB CREDO	0.630	0.145	0.539	0.006
Rv2176.1	17	4asd_BAX_A_1500 PDB CREDO	0.590	0.191	0.539	0.006
Rv2176.1	2	1ie4_T44_A_128 PDB CREDO	0.630	0.145	0.538	0.006
Rv2176.1	4	1s9p_DES_D_600 PDB CREDO	0.636	0.139	0.537	0.006
Rv2176.1	17	3gcs_BAX_A_401 PDB CREDO	0.587	0.195	0.536	0.006
Rv2176.1	1	3d91_REM_A_350 PDB CREDO	0.567	0.221	0.535	0.006
Rv2176.1	2	2zva_1N1_A_513 PDB CREDO	0.577	0.207	0.534	0.006
Rv2176.1	4	3cs9_NIL_A_600 PDB CREDO	0.742	0.052	0.534	0.006
Rv2176.1	4	3u7s_017_A_201 PDB CREDO	0.570	0.217	0.534	0.007
Rv2176.1	1	1hwi_115_D_3 PDB CREDO	0.639	0.136	0.533	0.007
Rv2176.1	17	1uwh_BAX_A_1723 PDB CREDO	0.550	0.244	0.533	0.007
Rv2176.1	17	1uwh_BAX_B_1723 PDB CREDO	0.550	0.244	0.533	0.007
Rv2176.1	2	2ity_IRE_A_2020 PDB CREDO	0.576	0.209	0.533	0.007
Rv2176.1	2	1ie4_T44_B_328 PDB CREDO	0.553	0.240	0.532	0.007
Rv2176.1	1	1hwi_115_B_1 PDB CREDO	0.634	0.140	0.530	0.007
Rv2176.1	1	3tne_RIT_A_401 PDB CREDO	0.633	0.141	0.529	0.007
Rv2176.1	1	1uwj_BAX_B_1723 PDB CREDO	0.560	0.230	0.528	0.007
Rv2176.1	1	3d91_REM_B_350 PDB CREDO	0.560	0.230	0.528	0.007
Rv2176.1	4	2hyy_STI_A_600 PDB CREDO	0.675	0.101	0.528	0.007
Rv2176.1	4	3ms9_STI_A_1 PDB CREDO	0.675	0.101	0.528	0.007
Rv2176.1	2	2ito_IRE_A_2020 PDB CREDO	0.528	0.275	0.528	0.007
Rv2176.1	4	3rgf_BAX_A_465 PDB CREDO	0.694	0.086	0.528	0.007
Rv2176.1	4	2hyy_STI_D_600 PDB CREDO	0.674	0.102	0.528	0.007
Rv2176.1	4	3gvu_STI_A_1001 PDB CREDO	0.674	0.102	0.528	0.007
Rv2176.1	4	3mss_STI_A_1 PDB CREDO	0.674	0.102	0.528	0.007
Rv2176.1	4	3mss_STI_B_1 PDB CREDO	0.674	0.102	0.528	0.007
Rv2176.1	4	3mss_STI_D_1 PDB CREDO	0.674	0.102	0.528	0.007
Rv2176.1	17	2y6o_1N1_A_1892 PDB CREDO	0.561	0.229	0.527	0.007
Rv2176.1	4	2hyy_STI_C_600 PDB CREDO	0.672	0.104	0.526	0.007
Rv2176.1	4	3pyy_STI_B_4 PDB CREDO	0.672	0.104	0.526	0.007
Rv2176.1	4	1iep_STI_B_202 PDB CREDO	0.672	0.104	0.526	0.007
Rv2176.1	4	3k5v_STI_B_2 PDB CREDO	0.672	0.104	0.526	0.007
Rv2176.1	2	2uxo_TAC_B_1211 PDB CREDO	0.591	0.190	0.525	0.007
Rv2176.1	4	3pyy_STI_A_3 PDB CREDO	0.671	0.105	0.525	0.007
Rv2176.1	1	1z2b_VLB_C_800 PDB CREDO	0.573	0.213	0.525	0.007
Rv2176.1	4	1iep_STI_A_201 PDB CREDO	0.670	0.106	0.525	0.007
Rv2176.1	4	3ms9_STI_B_1 PDB CREDO	0.670	0.106	0.525	0.007
Rv2176.1	4	3mss_STI_C_1 PDB CREDO	0.670	0.106	0.525	0.007
Rv2176.1	3	3glq_RAB_B_602 PDB CREDO	0.618	0.158	0.524	0.008
Rv2176.1	4	2z54_AB1_A_200 PDB CREDO	0.650	0.125	0.524	0.008
Rv2176.1	1	1xkk_FMM_A_91 PDB CREDO	0.651	0.123	0.524	0.008
Rv2176.1	4	3erd_DES_A_600 PDB CREDO	0.643	0.132	0.524	0.008
Rv2176.1	17	3heg_BAX_A_1 PDB CREDO	0.556	0.236	0.523	0.008
Rv2176.1	1	1sa1_POD_B_700 PDB CREDO	0.554	0.238	0.523	0.008
Rv2176.1	3	3glq_RAB_A_602 PDB CREDO	0.615	0.161	0.522	0.008
Rv2176.1	3	3n58_ADN_C_500 PDB CREDO	0.614	0.162	0.521	0.008
Rv2176.1	17	1uwj_BAX_B_1723 PDB CREDO	0.570	0.217	0.521	0.008
Rv2176.1	4	3cs9_NIL_B_600 PDB CREDO	0.742	0.052	0.519	0.008
Rv2176.1	2	1sn0_T44_C_601 PDB CREDO	0.722	0.065	0.519	0.008
Rv2176.1	1	3spk_TPV_B_100 PDB CREDO	0.534	0.267	0.519	0.008
Rv2176.1	3	3g1u_ADN_B_438 PDB CREDO	0.611	0.166	0.518	0.008
Rv2176.1	3	3ond_ADN_B_507 PDB CREDO	0.540	0.258	0.518	0.008
Rv2176.1	4	3k5v_STI_A_2 PDB CREDO	0.699	0.081	0.517	0.008
Rv2176.1	3	2xrl_DXT_A_1211 PDB CREDO	0.517	0.292	0.517	0.008
Rv2176.1	4	2rkg_AB1_B_501 PDB CREDO	0.586	0.196	0.517	0.008
Rv2176.1	1	3ut5_LOC_D_502 PDB CREDO	0.619	0.157	0.516	0.009
Rv2176.1	2	3uud_EST_A_600 PDB CREDO	0.580	0.203	0.516	0.009
Rv2176.1	1	3ut5_LOC_B_502 PDB CREDO	0.580	0.203	0.516	0.009
Rv2176.1	2	1g50_EST_A_600 PDB CREDO	0.580	0.204	0.515	0.009
Rv2176.1	2	3uud_EST_B_600 PDB CREDO	0.580	0.204	0.515	0.009
Rv2176.1	4	1opj_STI_A_3 PDB CREDO	0.715	0.069	0.515	0.009
Rv2176.1	2	3ols_EST_A_600 PDB CREDO	0.579	0.205	0.515	0.009
Rv2176.1	17	2hyy_STI_B_600 PDB CREDO	0.547	0.249	0.514	0.009
Rv2176.1	4	1opj_STI_B_4 PDB CREDO	0.714	0.070	0.514	0.009
Rv2176.1	2	2yja_EST_B_1550 PDB CREDO	0.578	0.206	0.514	0.009
Rv2176.1	1	1uwh_BAX_B_1723 PDB CREDO	0.578	0.206	0.513	0.009
Rv2176.1	2	1s9p_DES_B_459 PDB CREDO	0.555	0.238	0.513	0.009
Rv2176.1	1	1uwh_BAX_A_1723 PDB CREDO	0.578	0.207	0.513	0.009
Rv2176.1	1	1t46_STI_A_3 PDB CREDO	0.605	0.173	0.513	0.009
Rv2176.1	4	2hw2_RFP_A_1200 PDB CREDO	0.547	0.248	0.513	0.009
Rv2176.1	3	3kp5_KAN_A_2001 PDB CREDO	0.558	0.233	0.513	0.009
Rv2176.1	1	3tne_RIT_B_401 PDB CREDO	0.614	0.163	0.513	0.009
Rv2176.1	3	3ubo_ADN_A_353 PDB CREDO	0.512	0.299	0.512	0.009
Rv2176.1	2	3ols_EST_B_600 PDB CREDO	0.576	0.208	0.512	0.009
Rv2176.1	4	2qhc_AB1_B_9001 PDB CREDO	0.673	0.103	0.512	0.009
Rv2176.1	4	2b7z_MK1_B_200 PDB CREDO	0.654	0.120	0.512	0.009
Rv2176.1	2	1s9p_DES_C_500 PDB CREDO	0.552	0.241	0.511	0.009
Rv2176.1	2	3bbt_FMM_B_91 PDB CREDO	0.511	0.301	0.511	0.009
Rv2176.1	2	3ads_IMN_B_3 PDB CREDO	0.650	0.124	0.510	0.009
Rv2176.1	4	1mui_AB1_B_100 PDB CREDO	0.579	0.206	0.510	0.009
Rv2176.1	3	3r9c_ECL_A_452 PDB CREDO	0.532	0.270	0.510	0.009
Rv2176.1	3	3n58_ADN_D_500 PDB CREDO	0.674	0.102	0.509	0.009
Rv2176.1	2	3erd_DES_B_800 PDB CREDO	0.569	0.218	0.509	0.009
Rv2176.1	3	3g1u_ADN_A_438 PDB CREDO	0.600	0.179	0.509	0.009
Rv2176.1	1	3frq_ERY_B_195 PDB CREDO	0.610	0.168	0.509	0.010
Rv2176.1	4	2j7y_E3O_A_1454 PDB CREDO	0.697	0.083	0.508	0.010
Rv2176.1	1	1sa1_POD_D_701 PDB CREDO	0.555	0.237	0.508	0.010
Rv2176.1	2	1jzs_MRC_A_1301 PDB CREDO	0.508	0.306	0.508	0.010
Rv2176.1	2	3adx_IMN_B_3 PDB CREDO	0.571	0.216	0.507	0.010
Rv2176.1	1	3q70_RIT_A_2001 PDB CREDO	0.553	0.240	0.506	0.010
Rv2176.1	1	3tkd_CYZ_B_267 PDB CREDO	0.570	0.217	0.506	0.010
Rv2176.1	3	3ubo_ADN_B_353 PDB CREDO	0.505	0.310	0.505	0.010
Rv2176.1	1	1hwi_115_A_2 PDB CREDO	0.666	0.109	0.505	0.010
Rv2176.1	4	3cs9_NIL_C_600 PDB CREDO	0.760	0.042	0.505	0.010
Rv2176.1	4	3gp0_NIL_A_1 PDB CREDO	0.781	0.033	0.504	0.010
Rv2176.1	2	1uay_ADN_A_1001 PDB CREDO	0.735	0.057	0.504	0.010
Rv2176.1	2	1s9p_DES_A_459 PDB CREDO	0.583	0.199	0.504	0.010
Rv2176.1	3	1v8b_ADN_B_1502 PDB CREDO	0.525	0.279	0.504	0.010
Rv2176.1	4	1bsx_T3_A_1 PDB CREDO	0.503	0.313	0.503	0.010
Rv2176.1	4	1bsx_T3_B_2 PDB CREDO	0.503	0.313	0.503	0.010
Rv2176.1	17	2oiq_STI_A_1001 PDB CREDO	0.535	0.265	0.503	0.010
Rv2176.1	17	1hwi_115_D_3 PDB CREDO	0.519	0.289	0.503	0.010
Rv2176.1	1	2v0z_C41_O_1327 PDB CREDO	0.608	0.169	0.502	0.011
Rv2176.1	4	2bpx_MK1_B_902 PDB CREDO	0.678	0.098	0.502	0.011
Rv2176.1	3	1v8b_ADN_D_3502 PDB CREDO	0.524	0.282	0.502	0.011
Rv2176.1	4	3uvv_T3_A_501 PDB CREDO	0.518	0.291	0.501	0.011
Rv2176.1	17	1hwi_115_B_1 PDB CREDO	0.517	0.292	0.501	0.011
Rv2176.1	3	3ce6_ADN_C_500 PDB CREDO	0.662	0.113	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Target name	CHEMBL ID	SMILES
Plk1(PBD)	CC(C)C1=CC(=O)C(C)=CC1=O
Plk1(PBD)	CC(C)C1=CC(=N/O)C(C)=CC1=O

STITCH interactions

No high confidence interactions