Rv2146c

Tuberculist information
Gene nameRv2146c
Protein functionPossible conserved transmembrane protein
Functional category(tuberculist)cell wall and cell processes
Gene location(kb)2405.67
Molecular mass(da)10804.3
External sites TB Database TubercuList WebTB
Protein sequence
Number of amino acids : 96
	  		  	1    LVVFFQILGFALFIFWLLLIARVVVEFIRSFSRDWRPTGVTVVILEIIMSITDPPVKVLR   60
			  	61   RLIPQLTIGAVRFDLSIMVLLLVAFIGMQLAFGAAA

Known structures in the PDB
No Known structures
1 10 19 28 37 46 55 64 73 82 91 Range: 8 to 94  |  Coverage: 89% YGGT
Number of amino acids : 96
Domains assigned based on sequence. Mtb Structural proteome models CHOPIN models
Profile-based domain assignment
Structural/Functional domain familyPfam acc.no./SCOP IDDomain Region
YGGTPF023258-94
Mtb Structural Proteome models
Structure models not available for this query
Structure Models from Chopin
CHOPIN models not available for this query
Binding pockets
Structure models not available for this query
STRING
Cytoscape Web will replace the contents of this div with protein-protein interaction network.
Protein interacting with Rv2146cGene nameConfidence Score
Rv2144cRv2144c0.902
Rv2145cwag310.902
Potential ligand/drug binding sites
No binding sites identified
Similarity to known drug target from sensitive sequence analysis
No drug targets
List of small molecules tested from TIBLE
Data not available
Off-target activity - ligand based from TIBLE
Data not available
Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.
Data not available
STITCH interactions  
No high confidence interactions