SInCRe - Rv1988

Tuberculist information

Gene name	erm(37)
Protein function	Probable 23S rRNA methyltransferase Erm(37)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	2231.68
Molecular mass(da)	19573.9
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 179

	  		  	1    VSALGRSRRAWGWHRLHDEWAARVVSAAAVRPGELVFDIGAGEGALTAHLVRAGARVVAV   60
			  	61   ELHPRRVGVLRERFPGITVVHADAASIRLPGRPFRVVANPPYGISSRLLRTLLAPNSGLV  120
			  	121  AADLVLQRALVCKFASRNARRFTLTVGLMLPRRAFLPPPHVDSAVLVVRRRKCGDWQGR

Known structures in the PDB

No Known structures

Number of amino acids : 179

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
RrnaAD	PF00398	5-175

Mtb Structural Proteome models

Model Number	1
Model name	Rv1988
Template	1ZQ9 APDB CREDO
Template coverage	36_225
Template Identity(%)	30.1
Model coverage(%)	92.2
Normalized DOPE score	-0.051

Structure Models from Chopin

Model Number	1
Profile	c.66.1.24 Click for model details
zscore	35.12
Residue begin	5
Residue end	179

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1988	Gene name	Confidence Score
Rv0892	Rv0892	0.957

Potential ligand/drug binding sites

No binding sites identified

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
Se-adenosylselenomethioninePubChem	0.9	445.332
Co-APubChem	0.9	767.534
methanolPubChem	0.9	30.026
N5,N10-methylenetetrahydrofolatePubChem	0.9	457.44
deuteriumPubChem	0.9	2.01588
protiumPubChem	0.9	2.01576
tetrahydrofolatePubChem	0.9	445.429
acetyl coenzyme-APubChem	0.9	809.571
acetyl-CoAPubChem	0.9	809.571
1-hydroxyphenanthrenePubChem	0.9	194.229
H(+)PubChem	0.9	2.01588
coenzyme APubChem	0.9	767.534
methyltetrahydrofolatePubChem	0.9	459.456
L-histidinePubChem	0.9	155.155
H4FPubChem	0.9	445.429
5,10-methylenetetrahydrofolatePubChem	0.9	457.44
5-methyltetrahydrofolatePubChem	0.9	459.456
C05692PubChem	0.9	431.306
an aldehydePubChem	0.9	30.026
carbon monoxidePubChem	0.9	28.0101