SInCRe - Rv1937

Tuberculist information

Gene name	Rv1937
Protein function	Possible oxygenase
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	2188.5
Molecular mass(da)	93428.7
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 839

	  		  	1    MAVRQVTVGYSDGTHKTMPVRCDQTVLDAAEEHGVAIVNECQSGICGTCVATCTAGRYQM   60
			  	61   GRTEGLSDVERAARKILTCQTFVTSDCRIELQYPVDDNAALLVTGDGVVTAVELVSPSTA  120
			  	121  ILRVDTSGMAGALRYRAGQFAQLQVPGTNVWRNYSYAHPADGRGECEFIIRLLPDGVMSN  180
			  	181  YLRDRAQPGDHIALRCSKGSFYLRPIVRPVILVAGGTGLSAILAMAQSLDADVAHPVYLL  240
			  	241  YGVERTEDLCKLDELTELRRRVGRLEVHVVVARPDPDWDGRTGLVTDLLDERMLASGDAD  300
			  	301  VYLCGPVAMVDAARTWLDHNGFHRVGLYYEKFVASGAARRRTPARLDYAGVDIAEVCRRG  360
			  	361  RGTAVVIGGSIAGIAAAKMLSETFDRVIVLEKDGPHRRREGRPGAAQGWHLHHLLTAGQI  420
			  	421  ELERIFPGIVDDMVREGAFKVDMAAQYRIRLGGTWKKPGTSDIEIVCAGRPLLEWCVRRR  480
			  	481  LDDEPRIDFRYESEVADLAFDRANNAIVGVAVDNGDADGGDGLQVVPAEFVVDASGKNTR  540
			  	541  VPEFLERLGVGAPEAEQDIINCFYSTMQHRVPPERRWQDKVMVICYAYRPFEDTYAAQYY  600
			  	601  TDSSRTILSTSLVAYNCYSPPRTAREFRAFADLMPSPVIGENIDGLEPASPIYNFRYPNM  660
			  	661  LRLRYEKKRNLPRALLAVGDAYTSADPVSGLGMSLALKEVREMQALLAKYGAGHRDLPRR  720
			  	721  YYRAIAKMADTAWFVIREQNLRFDWMKDVDKKRPFYFGVLTWYMDRVLELVHDDLDAYRE  780
			  	781  FLAVVHLVKPPSALMRPRIASRVLGKWARTRLSGQKTLIARNYENHPIPAEPADQLVNA

Known structures in the PDB

No Known structures

Number of amino acids : 839

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Fer2	PF00111	10-84
FAD_binding_6	PF00970	106-203
NAD_binding_1	PF00175	212-315

Mtb Structural Proteome models

Model Number	1
Model name	Rv1937
Template	1KRH APDB CREDO
Template coverage	2_335
Template Identity(%)	34.4
Model coverage(%)	39.3
Normalized DOPE score	-0.58

Model Number	2
Model name	Rv1937.6
Template	1K0I APDB CREDO
Template coverage	1_389
Template Identity(%)	14.4
Model coverage(%)	50.7
Normalized DOPE score	0.304

Model Number	3
Model name	Rv1937.2
Template	2PIA APDB CREDO
Template coverage	8_274
Template Identity(%)	19.1
Model coverage(%)	33.1
Normalized DOPE score	0.313

Model Number	4
Model name	Rv1937.3
Template	2PIA APDB CREDO
Template coverage	12_319
Template Identity(%)	18.2
Model coverage(%)	36.5
Normalized DOPE score	0.681

Model Number	5
Model name	Rv1937.5
Template	1D4D APDB CREDO
Template coverage	20_569
Template Identity(%)	13.2
Model coverage(%)	52.4
Normalized DOPE score	0.827

Structure Models from Chopin

Model Number	1
Profile	b.43.4.2, c.25.1.2, d.15.4.2 - 2.40.30.10, 3.10.20.30, 3.40.50.80 Click for model details
zscore	33.94
Residue begin	2
Residue end	335

Model Number	2
Profile	b.43.4.2, c.25.1.2 - 2.40.30.10, 3.40.50.80 Click for model details
zscore	24.22
Residue begin	95
Residue end	338

Model Number	3
Profile	c.25.1.1 Click for model details
zscore	20.98
Residue begin	212
Residue end	315

Model Number	4
Profile	c.25.1.1 Click for model details
zscore	19.69
Residue begin	190
Residue end	353

Model Number	5
Profile	d.15.4.2 - 3.10.20.30 Click for model details
zscore	18.66
Residue begin	10
Residue end	84

Model Number	6
Profile	b.43.4.2 Click for model details
zscore	13.3
Residue begin	106
Residue end	203

Model Number	7
Profile	c.3.1.6 - 3.50.50.60 Click for model details
zscore	5.53
Residue begin	363
Residue end	414

Model Number	8
Profile	c.87.1.1 Click for model details
zscore	4.69
Residue begin	461
Residue end	787

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1937	Gene name	Confidence Score
Rv1941	Rv1941	0.979
Rv1936	Rv1936	0.925

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1937.6	6	3bjw_SVR_B_501 PDB CREDO	0.679	0.098	0.629	0.001
Rv1937.6	6	3bjw_SVR_F_502 PDB CREDO	0.679	0.098	0.629	0.001
Rv1937.6	6	3bjw_SVR_H_504 PDB CREDO	0.676	0.101	0.626	0.001
Rv1937.3	3	2xkw_P1B_A_1478 PDB CREDO	0.698	0.082	0.617	0.002
Rv1937.6	6	2xkw_P1B_A_1478 PDB CREDO	0.649	0.126	0.617	0.002
Rv1937.3	3	3sm2_478_A_126 PDB CREDO	0.673	0.103	0.610	0.002
Rv1937.3	3	1xkk_FMM_A_91 PDB CREDO	0.699	0.081	0.602	0.002
Rv1937.5	13	1uob_PNN_A_1311 PDB CREDO	0.619	0.157	0.601	0.002
Rv1937.6	6	3bjw_SVR_E_503 PDB CREDO	0.693	0.086	0.593	0.002
Rv1937.6	5	2y7j_B49_B_1294 PDB CREDO	0.615	0.162	0.591	0.002
Rv1937.2	4	1kij_NOV_B_444 PDB CREDO	0.589	0.193	0.589	0.003
Rv1937.6	6	3kk6_CEL_A_701 PDB CREDO	0.625	0.151	0.579	0.003
Rv1937.3	19	3oxc_ROC_A_401 PDB CREDO	0.603	0.176	0.578	0.003
Rv1937.2	3	1uho_VDN_A_1000 PDB CREDO	0.600	0.179	0.576	0.003
Rv1937.3	3	3bjw_SVR_B_501 PDB CREDO	0.668	0.107	0.575	0.003
Rv1937.6	6	3bjw_SVR_H_511 PDB CREDO	0.575	0.211	0.575	0.003
Rv1937.5	13	1y0x_T44_X_500 PDB CREDO	0.573	0.212	0.573	0.003
Rv1937.2	4	3qlg_1N1_A_601 PDB CREDO	0.595	0.185	0.573	0.003
Rv1937.3	3	3bjw_SVR_H_504 PDB CREDO	0.664	0.111	0.572	0.003
Rv1937.6	6	3bjw_SVR_F_509 PDB CREDO	0.571	0.216	0.571	0.004
Rv1937.2	4	3g5d_1N1_A_1 PDB CREDO	0.592	0.189	0.570	0.004
Rv1937.2	4	3g5d_1N1_B_1 PDB CREDO	0.592	0.189	0.570	0.004
Rv1937.6	6	3kk6_CEL_B_1701 PDB CREDO	0.683	0.094	0.569	0.004
Rv1937.6	6	3bjw_SVR_E_510 PDB CREDO	0.567	0.220	0.567	0.004
Rv1937.3	3	1t46_STI_A_3 PDB CREDO	0.694	0.086	0.567	0.004
Rv1937.3	3	3bjw_SVR_F_502 PDB CREDO	0.658	0.117	0.567	0.004
Rv1937.3	3	1ya4_CTX_A_1 PDB CREDO	0.580	0.204	0.566	0.004
Rv1937.2	4	3qlg_1N1_B_601 PDB CREDO	0.588	0.193	0.566	0.004
Rv1937.5	13	1uwj_BAX_B_1723 PDB CREDO	0.600	0.178	0.565	0.004
Rv1937.6	6	3b0w_DGX_B_1 PDB CREDO	0.714	0.070	0.564	0.004
Rv1937.2	2	3mdv_CL6_B_506 PDB CREDO	0.561	0.229	0.561	0.004
Rv1937.2	2	2eva_ADN_A_498 PDB CREDO	0.559	0.232	0.559	0.004
Rv1937.3	19	3k4v_ROC_B_201 PDB CREDO	0.570	0.216	0.558	0.004
Rv1937.6	6	1skx_RFP_A_1 PDB CREDO	0.669	0.106	0.558	0.004
Rv1937.3	3	3bjw_SVR_E_503 PDB CREDO	0.698	0.082	0.556	0.005
Rv1937.6	6	3nxu_RIT_B_600 PDB CREDO	0.667	0.109	0.556	0.005
Rv1937.5	13	1uwh_BAX_A_1723 PDB CREDO	0.555	0.237	0.555	0.005
Rv1937.2	4	2zva_1N1_A_513 PDB CREDO	0.599	0.180	0.554	0.005
Rv1937.6	6	3nxu_RIT_A_600 PDB CREDO	0.664	0.111	0.554	0.005
Rv1937.5	13	1uwh_BAX_B_1723 PDB CREDO	0.553	0.240	0.553	0.005
Rv1937.2	2	3uq6_ADN_B_401 PDB CREDO	0.609	0.169	0.553	0.005
Rv1937.3	19	1xkk_FMM_A_91 PDB CREDO	0.821	0.018	0.552	0.005
Rv1937.2	3	1jip_KTN_A_801 PDB CREDO	0.552	0.241	0.552	0.005
Rv1937.3	19	3ndt_ROC_A_101 PDB CREDO	0.574	0.211	0.551	0.005
Rv1937.2	2	3uq6_ADN_A_401 PDB CREDO	0.606	0.172	0.550	0.005
Rv1937.5	13	1xzx_T3_X_500 PDB CREDO	0.603	0.175	0.549	0.005
Rv1937.5	13	3vn2_TLS_A_501 PDB CREDO	0.566	0.222	0.549	0.005
Rv1937.3	19	3tkg_ROC_B_801 PDB CREDO	0.549	0.245	0.549	0.005
Rv1937.3	19	3gp0_NIL_A_1 PDB CREDO	0.837	0.013	0.548	0.005
Rv1937.2	4	3oht_1N1_A_1000 PDB CREDO	0.569	0.218	0.548	0.005
Rv1937.5	13	3uvv_T3_A_501 PDB CREDO	0.602	0.177	0.548	0.005
Rv1937.6	6	3bjw_SVR_B_512 PDB CREDO	0.591	0.190	0.548	0.005
Rv1937.5	13	3gws_T3_X_500 PDB CREDO	0.619	0.157	0.546	0.005
Rv1937.5	13	1uwj_BAX_A_1723 PDB CREDO	0.632	0.143	0.546	0.005
Rv1937.3	3	3gp0_NIL_A_1 PDB CREDO	0.650	0.124	0.546	0.005
Rv1937.3	3	3cs9_NIL_D_600 PDB CREDO	0.666	0.109	0.545	0.005
Rv1937.3	3	3cs9_NIL_C_600 PDB CREDO	0.666	0.109	0.544	0.005
Rv1937.3	3	2qxs_RAL_A_600 PDB CREDO	0.701	0.080	0.543	0.006
Rv1937.3	3	3kk6_CEL_A_701 PDB CREDO	0.629	0.146	0.542	0.006
Rv1937.5	13	1bsx_T3_A_1 PDB CREDO	0.614	0.163	0.541	0.006
Rv1937.5	13	1bsx_T3_B_2 PDB CREDO	0.614	0.163	0.541	0.006
Rv1937.3	3	3b0w_DGX_B_1 PDB CREDO	0.738	0.055	0.541	0.006
Rv1937.6	6	3bjw_SVR_C_505 PDB CREDO	0.631	0.144	0.540	0.006
Rv1937.2	3	3sxr_1N1_B_2 PDB CREDO	0.563	0.226	0.540	0.006
Rv1937.3	3	2qxs_RAL_B_600 PDB CREDO	0.697	0.083	0.540	0.006
Rv1937.2	2	1lik_ADN_A_699 PDB CREDO	0.539	0.260	0.539	0.006
Rv1937.3	3	1uwj_BAX_A_1723 PDB CREDO	0.756	0.044	0.539	0.006
Rv1937.5	13	1fm6_BRL_X_504 PDB CREDO	0.592	0.189	0.539	0.006
Rv1937.6	6	3bjw_SVR_G_506 PDB CREDO	0.612	0.165	0.539	0.006
Rv1937.3	3	3cs9_NIL_A_600 PDB CREDO	0.714	0.071	0.538	0.006
Rv1937.5	13	2hw2_RFP_A_1200 PDB CREDO	0.572	0.214	0.538	0.006
Rv1937.3	3	3cs9_NIL_B_600 PDB CREDO	0.694	0.085	0.538	0.006
Rv1937.2	4	3kw2_ADN_A_300 PDB CREDO	0.558	0.233	0.537	0.006
Rv1937.3	3	2qak_1UN_A_1001 PDB CREDO	0.577	0.207	0.536	0.006
Rv1937.3	3	2q64_1UN_B_1001 PDB CREDO	0.577	0.208	0.536	0.006
Rv1937.2	3	1wu8_ADN_B_501 PDB CREDO	0.559	0.232	0.536	0.006
Rv1937.3	3	2pym_1UN_A_1001 PDB CREDO	0.575	0.210	0.534	0.006
Rv1937.2	4	2ity_IRE_A_2020 PDB CREDO	0.577	0.207	0.534	0.006
Rv1937.2	3	1xos_VIA_A_1 PDB CREDO	0.580	0.204	0.533	0.007
Rv1937.2	2	1lii_ADN_A_699 PDB CREDO	0.533	0.268	0.533	0.007
Rv1937.3	3	2pyn_1UN_A_1001 PDB CREDO	0.573	0.213	0.533	0.007
Rv1937.2	4	1jzs_MRC_A_1301 PDB CREDO	0.532	0.270	0.532	0.007
Rv1937.3	3	2q63_1UN_A_1001 PDB CREDO	0.572	0.214	0.532	0.007
Rv1937.2	3	3sxr_1N1_A_1 PDB CREDO	0.577	0.208	0.532	0.007
Rv1937.6	5	2pgr_DCF_A_501 PDB CREDO	0.619	0.157	0.531	0.007
Rv1937.2	3	1xot_VDN_A_101 PDB CREDO	0.577	0.207	0.531	0.007
Rv1937.5	13	3qt0_486_A_4 PDB CREDO	0.665	0.110	0.531	0.007
Rv1937.5	4	1d4f_ADN_C_603 PDB CREDO	0.588	0.193	0.531	0.007
Rv1937.2	3	2iyf_ERY_A_1400 PDB CREDO	0.552	0.241	0.530	0.007
Rv1937.6	5	2pgf_ADN_A_501 PDB CREDO	0.595	0.186	0.530	0.007
Rv1937.2	4	3k54_1N1_A_1 PDB CREDO	0.570	0.216	0.529	0.007
Rv1937.3	19	3ndu_ROC_D_100 PDB CREDO	0.617	0.159	0.529	0.007
Rv1937.2	3	2ydo_ADN_A_400 PDB CREDO	0.601	0.178	0.529	0.007
Rv1937.3	19	2nmy_ROC_A_401 PDB CREDO	0.603	0.176	0.529	0.007
Rv1937.2	2	3mdv_CL6_A_506 PDB CREDO	0.610	0.167	0.529	0.007
Rv1937.5	13	2h79_T3_A_1 PDB CREDO	0.619	0.157	0.528	0.007
Rv1937.3	3	1c6z_ROC_B_505 PDB CREDO	0.568	0.219	0.528	0.007
Rv1937.3	19	2qak_1UN_A_1001 PDB CREDO	0.728	0.061	0.528	0.007
Rv1937.2	3	1hk2_T44_A_3003 PDB CREDO	0.551	0.243	0.528	0.007
Rv1937.3	19	3sm2_478_A_126 PDB CREDO	0.746	0.050	0.528	0.007
Rv1937.2	4	2ito_IRE_A_2020 PDB CREDO	0.528	0.276	0.528	0.007
Rv1937.3	3	2v0z_C41_C_1328 PDB CREDO	0.582	0.201	0.528	0.007
Rv1937.2	3	3nrr_D16_A_520 PDB CREDO	0.599	0.180	0.527	0.007
Rv1937.2	4	1kij_NOV_A_400 PDB CREDO	0.655	0.120	0.527	0.007
Rv1937.3	3	3ufn_ROC_A_401 PDB CREDO	0.628	0.147	0.527	0.007
Rv1937.5	13	3ln1_CEL_B_682 PDB CREDO	0.598	0.182	0.527	0.007
Rv1937.5	13	3ln1_CEL_C_682 PDB CREDO	0.598	0.182	0.527	0.007
Rv1937.3	19	2q64_1UN_B_1001 PDB CREDO	0.726	0.062	0.527	0.007
Rv1937.3	19	3el4_ROC_A_100 PDB CREDO	0.659	0.116	0.527	0.007
Rv1937.2	3	1udt_VIA_A_1000 PDB CREDO	0.625	0.150	0.526	0.007
Rv1937.5	13	3ln1_CEL_A_682 PDB CREDO	0.597	0.183	0.526	0.007
Rv1937.2	3	3k2h_LYA_A_514 PDB CREDO	0.593	0.188	0.526	0.007
Rv1937.2	3	1jin_KTN_A_801 PDB CREDO	0.570	0.217	0.525	0.007
Rv1937.3	19	1t46_STI_A_3 PDB CREDO	0.823	0.017	0.525	0.007
Rv1937.3	19	3k4v_ROC_D_201 PDB CREDO	0.642	0.133	0.525	0.007
Rv1937.3	3	3ndt_ROC_D_100 PDB CREDO	0.525	0.281	0.525	0.007
Rv1937.2	3	1fds_EST_A_350 PDB CREDO	0.571	0.216	0.525	0.007
Rv1937.3	19	2nnk_ROC_A_401 PDB CREDO	0.672	0.104	0.525	0.007
Rv1937.3	19	2pym_1UN_A_1001 PDB CREDO	0.723	0.064	0.525	0.007
Rv1937.3	19	2q63_1UN_A_1001 PDB CREDO	0.723	0.064	0.525	0.007
Rv1937.3	19	3ndt_ROC_D_100 PDB CREDO	0.671	0.105	0.524	0.008
Rv1937.3	19	2pyn_1UN_A_1001 PDB CREDO	0.722	0.065	0.524	0.008
Rv1937.3	3	2nnk_ROC_A_401 PDB CREDO	0.524	0.282	0.524	0.008
Rv1937.5	13	3b0w_DGX_B_1 PDB CREDO	0.623	0.152	0.523	0.008
Rv1937.3	19	1c6z_ROC_B_505 PDB CREDO	0.721	0.066	0.523	0.008
Rv1937.3	3	3el4_ROC_A_100 PDB CREDO	0.535	0.266	0.522	0.008
Rv1937.2	3	1pbc_BHA_A_396 PDB CREDO	0.620	0.156	0.522	0.008
Rv1937.5	13	2h77_T3_A_1 PDB CREDO	0.632	0.143	0.521	0.008
Rv1937.5	13	3frq_ERY_B_195 PDB CREDO	0.554	0.238	0.521	0.008
Rv1937.2	3	2iyf_ERY_B_1399 PDB CREDO	0.566	0.222	0.520	0.008
Rv1937.3	19	3ucb_017_A_201 PDB CREDO	0.666	0.109	0.520	0.008
Rv1937.2	4	2cbr_A80_A_201 PDB CREDO	0.540	0.258	0.520	0.008
Rv1937.2	3	1xp0_VDN_A_201 PDB CREDO	0.565	0.223	0.520	0.008
Rv1937.2	3	1udu_CIA_B_2003 PDB CREDO	0.564	0.224	0.519	0.008
Rv1937.6	5	2y7j_B49_D_1294 PDB CREDO	0.668	0.108	0.518	0.008
Rv1937.5	13	3bjw_SVR_E_503 PDB CREDO	0.670	0.105	0.518	0.008
Rv1937.2	4	2fum_MIX_D_3539 PDB CREDO	0.643	0.131	0.518	0.008
Rv1937.6	6	2v0z_C41_C_1328 PDB CREDO	0.531	0.272	0.518	0.008
Rv1937.2	4	2fum_MIX_A_539 PDB CREDO	0.577	0.208	0.516	0.009
Rv1937.3	3	1skx_RFP_A_1 PDB CREDO	0.666	0.109	0.516	0.009
Rv1937.5	13	1z2b_VLB_C_800 PDB CREDO	0.531	0.271	0.516	0.009
Rv1937.2	3	1fj8_CER_A_500 PDB CREDO	0.537	0.262	0.515	0.009
Rv1937.5	13	3tkd_CYZ_A_266 PDB CREDO	0.548	0.247	0.515	0.009
Rv1937.2	3	1a27_EST_A_350 PDB CREDO	0.581	0.203	0.515	0.009
Rv1937.2	3	2w8y_NDR_B_1000 PDB CREDO	0.558	0.233	0.515	0.009
Rv1937.5	13	3ln1_CEL_D_682 PDB CREDO	0.645	0.130	0.514	0.009
Rv1937.3	3	1opj_STI_A_3 PDB CREDO	0.682	0.095	0.514	0.009
Rv1937.3	3	3prs_RIT_A_1001 PDB CREDO	0.540	0.259	0.514	0.009
Rv1937.3	19	1t7i_017_A_200 PDB CREDO	0.643	0.132	0.514	0.009
Rv1937.3	19	3ndu_ROC_A_101 PDB CREDO	0.581	0.202	0.514	0.009
Rv1937.5	13	4asd_BAX_A_1500 PDB CREDO	0.545	0.250	0.514	0.009
Rv1937.5	13	3tkd_CYZ_B_267 PDB CREDO	0.513	0.298	0.513	0.009
Rv1937.6	6	1uwj_BAX_A_1723 PDB CREDO	0.669	0.107	0.513	0.009
Rv1937.6	6	1xkk_FMM_A_91 PDB CREDO	0.553	0.239	0.513	0.009
Rv1937.2	3	1fj8_CER_C_500 PDB CREDO	0.535	0.266	0.513	0.009
Rv1937.3	3	3kk6_CEL_B_1701 PDB CREDO	0.662	0.113	0.513	0.009
Rv1937.5	13	2oiq_STI_A_1001 PDB CREDO	0.528	0.275	0.512	0.009
Rv1937.2	3	2h42_VIA_B_902 PDB CREDO	0.671	0.105	0.512	0.009
Rv1937.2	3	3jwq_VIA_B_901 PDB CREDO	0.671	0.105	0.512	0.009
Rv1937.2	4	2xkw_P1B_B_1475 PDB CREDO	0.573	0.213	0.512	0.009
Rv1937.2	3	3u9f_CLM_K_221 PDB CREDO	0.512	0.300	0.512	0.009
Rv1937.2	4	3oht_1N1_B_1000 PDB CREDO	0.593	0.188	0.512	0.009
Rv1937.2	3	3nrr_D16_B_530 PDB CREDO	0.533	0.268	0.512	0.009
Rv1937.6	5	2zva_1N1_A_513 PDB CREDO	0.511	0.301	0.511	0.009
Rv1937.2	3	2bxg_IBP_B_2001 PDB CREDO	0.556	0.236	0.511	0.009
Rv1937.5	13	1zgy_BRL_A_503 PDB CREDO	0.619	0.157	0.511	0.009
Rv1937.3	3	2v0z_C41_O_1327 PDB CREDO	0.608	0.170	0.510	0.009
Rv1937.2	3	1mrl_DOL_A_300 PDB CREDO	0.532	0.270	0.510	0.009
Rv1937.2	3	2uxo_TAC_B_1211 PDB CREDO	0.531	0.271	0.510	0.009
Rv1937.6	6	1tco_FK5_C_509 PDB CREDO	0.537	0.263	0.510	0.009
Rv1937.2	4	1s9p_DES_B_459 PDB CREDO	0.551	0.242	0.510	0.009
Rv1937.6	6	3b0w_DGX_A_1 PDB CREDO	0.725	0.063	0.510	0.009
Rv1937.3	3	1opj_STI_B_4 PDB CREDO	0.676	0.101	0.509	0.009
Rv1937.2	4	1s9p_DES_C_500 PDB CREDO	0.551	0.243	0.509	0.009
Rv1937.3	19	1k6c_MK1_B_902 PDB CREDO	0.636	0.138	0.509	0.010
Rv1937.3	19	3d1x_ROC_A_201 PDB CREDO	0.531	0.271	0.509	0.010
Rv1937.5	13	3b0w_DGX_A_1 PDB CREDO	0.540	0.258	0.509	0.010
Rv1937.2	4	2uxo_TAC_B_1211 PDB CREDO	0.572	0.214	0.509	0.010
Rv1937.2	3	3adx_IMN_B_3 PDB CREDO	0.530	0.273	0.509	0.010
Rv1937.2	3	1fj8_CER_B_500 PDB CREDO	0.530	0.272	0.509	0.010
Rv1937.2	4	2itz_IRE_A_2021 PDB CREDO	0.571	0.215	0.508	0.010
Rv1937.5	13	1cil_ETS_A_263 PDB CREDO	0.636	0.138	0.508	0.010
Rv1937.2	2	3g0f_B49_B_9001 PDB CREDO	0.585	0.197	0.507	0.010
Rv1937.3	19	2xkw_P1B_A_1478 PDB CREDO	0.735	0.057	0.507	0.010
Rv1937.3	19	1rl8_RIT_A_9001 PDB CREDO	0.682	0.096	0.507	0.010
Rv1937.5	4	1d4f_ADN_D_604 PDB CREDO	0.627	0.148	0.507	0.010
Rv1937.5	9	3bjw_SVR_A_508 PDB CREDO	0.507	0.308	0.507	0.010
Rv1937.3	3	3ucb_017_A_201 PDB CREDO	0.507	0.308	0.507	0.010
Rv1937.5	9	1uob_PNN_A_1311 PDB CREDO	0.585	0.197	0.506	0.010
Rv1937.2	2	2nnj_225_A_501 PDB CREDO	0.506	0.309	0.506	0.010
Rv1937.5	4	1d4f_ADN_B_602 PDB CREDO	0.625	0.150	0.506	0.010
Rv1937.5	4	1kij_NOV_A_400 PDB CREDO	0.523	0.283	0.506	0.010
Rv1937.5	13	2hyy_STI_B_600 PDB CREDO	0.521	0.286	0.505	0.010
Rv1937.3	3	1tco_FK5_C_509 PDB CREDO	0.571	0.215	0.505	0.010
Rv1937.3	19	3tl9_ROC_A_401 PDB CREDO	0.549	0.245	0.504	0.010
Rv1937.3	19	3cyx_ROC_A_201 PDB CREDO	0.587	0.195	0.503	0.010
Rv1937.2	3	1fj8_CER_D_500 PDB CREDO	0.525	0.280	0.503	0.010
Rv1937.2	3	3b2r_VDN_A_1 PDB CREDO	0.598	0.181	0.503	0.010
Rv1937.2	4	2gqg_1N1_A_501 PDB CREDO	0.562	0.227	0.503	0.010
Rv1937.5	13	1hwl_FBI_B_1 PDB CREDO	0.518	0.290	0.503	0.010
Rv1937.6	6	1y0x_T44_X_500 PDB CREDO	0.759	0.043	0.502	0.011
Rv1937.2	2	3ay0_ADN_B_402 PDB CREDO	0.502	0.315	0.502	0.011
Rv1937.3	3	3k4v_ROC_D_201 PDB CREDO	0.527	0.278	0.502	0.011
Rv1937.2	3	1uof_PNN_A_1312 PDB CREDO	0.523	0.283	0.502	0.011
Rv1937.2	3	3g0e_B49_A_9000 PDB CREDO	0.523	0.283	0.502	0.011
Rv1937.2	3	1wu8_ADN_A_500 PDB CREDO	0.523	0.283	0.502	0.011
Rv1937.2	3	3b2r_VDN_B_1 PDB CREDO	0.596	0.184	0.502	0.011
Rv1937.5	13	1hwl_FBI_D_3 PDB CREDO	0.517	0.292	0.502	0.011
Rv1937.5	13	1hwi_115_D_3 PDB CREDO	0.533	0.268	0.501	0.011
Rv1937.2	3	3aod_RFP_C_2002 PDB CREDO	0.633	0.142	0.501	0.011
Rv1937.2	3	1fdu_EST_B_354 PDB CREDO	0.569	0.218	0.501	0.011
Rv1937.2	3	1kvl_CLS_A_371 PDB CREDO	0.595	0.185	0.501	0.011
Rv1937.2	3	2ayl_FLP_B_2701 PDB CREDO	0.501	0.317	0.501	0.011
Rv1937.5	13	1hwl_FBI_A_2 PDB CREDO	0.516	0.294	0.501	0.011
Rv1937.5	13	1hwl_FBI_C_4 PDB CREDO	0.516	0.294	0.501	0.011
Rv1937.5	13	3ads_IMN_A_2 PDB CREDO	0.649	0.125	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions