Rv1786

Tuberculist information
Gene nameRv1786
Protein functionProbable ferredoxin
Functional category(tuberculist)intermediary metabolism and respiration
Gene location(kb)2024.83
Molecular mass(da)7353.18
External sites TB Database TubercuList WebTB
Protein sequence
Number of amino acids : 67
	  		  	1    VKVRLDPSRCVGHAQCYAVDPDLFPIDDSGNSILAEHEVRPEDMQLTRDGVAACPEMALI   60
			  	61   LEEDDAD

Known structures in the PDB
No Known structures
1 7 13 19 25 31 37 43 49 55 61 Range: 3 to 61  |  Coverage: 86% Fer4_15 Range: 1 to 63  |  Coverage: 92% 1 Range: 1 to 67  |  Coverage: 98% 1
Number of amino acids : 67
Domains assigned based on sequence. Mtb Structural proteome models CHOPIN models
Profile-based domain assignment
Structural/Functional domain familyPfam acc.no./SCOP IDDomain Region
Fer4_15PF134593-61
Mtb Structural Proteome models
Model Number1
Model nameRv1786
Template1SJ1    APDBCREDO
Template coverage2_65
Template Identity(%)30.2
Model coverage(%)92.5
Normalized DOPE score-1.296

Structure Models from Chopin
Model Number1
Profiled.58.1.4 - 3.30.70.20
Click for model details
zscore12.47
Residue begin1
Residue end67
Binding pockets
STRING
Cytoscape Web will replace the contents of this div with protein-protein interaction network.
Protein interacting with Rv1786Gene nameConfidence Score
Rv1785ccyp1430.936
Potential ligand/drug binding sites
No binding sites identified
Similarity to known drug target from sensitive sequence analysis
No drug targets
List of small molecules tested from TIBLE
Data not available
Off-target activity - ligand based from TIBLE
Data not available
Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.
Data not available
STITCH interactions  
No high confidence interactions