SInCRe - Rv1746

Tuberculist information

Gene name	pknF
Protein function	Anchored-membrane serine/threonine-protein kinase PknF (protein kinase F) (STPK F)
Functional category(tuberculist)	regulatory proteins
Gene location(kb)	1972.14
Molecular mass(da)	50668.1
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 476

	  		  	1    MPLAEGSTFAGFTIVRQLGSGGMGEVYLARHPRLPRQDALKVLRADVSADGEYRARFNRE   60
			  	61   ADAAASLWHPHIVAVHDRGEFDGQLWIDMDFVDGTDTVSLLRDRYPNGMPGPEVTEIITA  120
			  	121  VAEALDYAHERRLLHRDVKPANILIANPDSPDRRIMLADFGIAGWVDDPSGLTATNMTVG  180
			  	181  TVSYAAPEQLMGNELDGRADQYALAATAFHLLTGSPPFQHANPAVVISQHLSASPPAIGD  240
			  	241  RVPELTPLDPVFAKALAKQPKDRYQRCVDFARALGHRLGGAGDPDDTRVSQPVAVAAPAK  300
			  	301  RSLLRTAVIVPAVLAMLLVMAVAVAVREFQRADDERAAQPARTRTTTSAGTTTSVAPAST  360
			  	361  TRPAPTTPTTTGAADTATASPTAAVVAIGALCFPLGSTGTTKTGATAYCSTLQGTNTTIW  420
			  	421  SLTEDTVASPTVTATADPTEAPLPIEQESPIRVCMQQTGQTRRECREEIRRSNGWP

Known structures in the PDB

No Known structures

Number of amino acids : 476

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Pkinase	PF00069	12-277

Mtb Structural Proteome models

Model Number	1
Model name	Rv1746
Template	2HAK APDB CREDO
Template coverage	50_357
Template Identity(%)	24.0
Model coverage(%)	71.8
Normalized DOPE score	0.534

Model Number	2
Model name	Rv1746.2
Template	1OMW APDB CREDO
Template coverage	188_663
Template Identity(%)	16.0
Model coverage(%)	97.7
Normalized DOPE score	0.816

Structure Models from Chopin

Model Number	1
Profile	d.144.1.7 Click for model details
zscore	17.87
Residue begin	1
Residue end	471

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1746	Gene name	Confidence Score
Rv1747	Rv1747	0.989
Rv1747	Rv1747	0.989
Rv1747	Rv1747	0.989
Rv0018c	pstP	0.972

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1746.2	35	2trt_TAC_A_222 PDB CREDO	0.641	0.133	0.616	0.002
Rv1746.2	35	2o7o_DXT_A_222 PDB CREDO	0.634	0.140	0.609	0.002
Rv1746.2	35	2xrl_DXT_A_1211 PDB CREDO	0.656	0.119	0.603	0.002
Rv1746.2	35	1jip_KTN_A_801 PDB CREDO	0.593	0.188	0.593	0.002
Rv1746.2	35	2vke_TAC_A_222 PDB CREDO	0.649	0.126	0.575	0.003
Rv1746.2	35	2xpw_OTC_A_222 PDB CREDO	0.647	0.127	0.574	0.003
Rv1746.2	35	2xn5_FUN_A_1356 PDB CREDO	0.598	0.182	0.574	0.003
Rv1746.2	8	1kij_NOV_A_400 PDB CREDO	0.630	0.145	0.570	0.004
Rv1746.2	8	3hec_STI_A_1 PDB CREDO	0.603	0.176	0.565	0.004
Rv1746.2	8	3oez_STI_B_601 PDB CREDO	0.602	0.177	0.564	0.004
Rv1746.2	35	3cs8_BRL_A_503 PDB CREDO	0.611	0.167	0.563	0.004
Rv1746.2	6	1kij_NOV_A_400 PDB CREDO	0.580	0.204	0.560	0.004
Rv1746.2	35	2uxo_TAC_B_1211 PDB CREDO	0.583	0.200	0.560	0.004
Rv1746.2	35	1ict_T44_C_128 PDB CREDO	0.556	0.235	0.556	0.005
Rv1746.2	16	4eb6_VLB_C_503 PDB CREDO	0.552	0.241	0.552	0.005
Rv1746.2	22	1d4f_ADN_D_604 PDB CREDO	0.572	0.215	0.551	0.005
Rv1746.2	16	3oct_1N1_A_663 PDB CREDO	0.590	0.191	0.550	0.005
Rv1746.2	16	3jwq_VIA_B_901 PDB CREDO	0.549	0.245	0.549	0.005
Rv1746.2	8	1qkn_RAL_A_600 PDB CREDO	0.549	0.245	0.549	0.005
Rv1746.2	35	1ict_T44_D_129 PDB CREDO	0.594	0.186	0.548	0.005
Rv1746.2	35	3adx_IMN_B_3 PDB CREDO	0.569	0.218	0.546	0.005
Rv1746.2	8	2fum_MIX_D_3539 PDB CREDO	0.603	0.175	0.546	0.005
Rv1746.2	35	3sxr_1N1_B_2 PDB CREDO	0.565	0.224	0.542	0.006
Rv1746.2	22	1d4f_ADN_B_602 PDB CREDO	0.561	0.229	0.541	0.006
Rv1746.2	35	3ri5_IVM_E_349 PDB CREDO	0.586	0.196	0.540	0.006
Rv1746.2	8	3gws_T3_X_500 PDB CREDO	0.538	0.261	0.538	0.006
Rv1746.2	35	1uho_VDN_A_1000 PDB CREDO	0.560	0.230	0.537	0.006
Rv1746.2	8	3v5w_8PR_A_701 PDB CREDO	0.537	0.262	0.537	0.006
Rv1746.2	35	2xn7_T44_A_1355 PDB CREDO	0.559	0.232	0.536	0.006
Rv1746.2	8	1bsx_T3_A_1 PDB CREDO	0.536	0.264	0.536	0.006
Rv1746.2	8	1bsx_T3_B_2 PDB CREDO	0.536	0.264	0.536	0.006
Rv1746.2	35	3f4x_KLT_A_300 PDB CREDO	0.628	0.148	0.536	0.006
Rv1746.2	8	2hyy_STI_B_600 PDB CREDO	0.626	0.149	0.536	0.006
Rv1746.2	22	3g1u_ADN_C_438 PDB CREDO	0.555	0.237	0.535	0.006
Rv1746.2	8	4asd_BAX_A_1500 PDB CREDO	0.644	0.131	0.534	0.006
Rv1746.2	8	2jfa_RAL_A_600 PDB CREDO	0.568	0.219	0.533	0.007
Rv1746.2	22	3n58_ADN_D_500 PDB CREDO	0.552	0.241	0.532	0.007
Rv1746.2	16	2xkw_P1B_B_1475 PDB CREDO	0.532	0.270	0.532	0.007
Rv1746.2	16	3k54_1N1_A_1 PDB CREDO	0.552	0.242	0.532	0.007
Rv1746.2	35	1jin_KTN_A_801 PDB CREDO	0.577	0.208	0.532	0.007
Rv1746.2	35	3sxr_1N1_A_1 PDB CREDO	0.577	0.208	0.532	0.007
Rv1746.2	22	1d4f_ADN_C_603 PDB CREDO	0.571	0.215	0.531	0.007
Rv1746.2	35	3aod_RFP_C_2002 PDB CREDO	0.671	0.105	0.531	0.007
Rv1746.2	8	1uwj_BAX_B_1723 PDB CREDO	0.640	0.135	0.531	0.007
Rv1746.2	35	3q1e_T44_D_328 PDB CREDO	0.577	0.207	0.531	0.007
Rv1746.2	8	1uwh_BAX_B_1723 PDB CREDO	0.602	0.177	0.531	0.007
Rv1746.2	22	2a68_RBT_C_8001 PDB CREDO	0.550	0.244	0.531	0.007
Rv1746.2	8	2y6o_1N1_A_1892 PDB CREDO	0.547	0.248	0.530	0.007
Rv1746.2	8	1uwh_BAX_A_1723 PDB CREDO	0.601	0.178	0.530	0.007
Rv1746.2	16	4eyb_0WO_A_303 PDB CREDO	0.549	0.246	0.529	0.007
Rv1746.2	22	3n58_ADN_A_500 PDB CREDO	0.569	0.218	0.529	0.007
Rv1746.2	16	3aod_RFP_C_2002 PDB CREDO	0.548	0.247	0.529	0.007
Rv1746.2	8	2oiq_STI_A_1001 PDB CREDO	0.618	0.158	0.528	0.007
Rv1746.2	22	3ce6_ADN_C_500 PDB CREDO	0.548	0.247	0.528	0.007
Rv1746.2	22	3ce6_ADN_D_500 PDB CREDO	0.548	0.247	0.528	0.007
Rv1746.2	16	3oht_1N1_A_1000 PDB CREDO	0.567	0.220	0.527	0.007
Rv1746.2	35	3r9c_ECL_A_452 PDB CREDO	0.550	0.244	0.527	0.007
Rv1746.2	6	2fum_MIX_D_3539 PDB CREDO	0.546	0.250	0.527	0.007
Rv1746.2	16	2cbr_A80_A_201 PDB CREDO	0.567	0.221	0.527	0.007
Rv1746.2	22	3ce6_ADN_B_500 PDB CREDO	0.546	0.249	0.527	0.007
Rv1746.2	8	3uvv_T3_A_501 PDB CREDO	0.544	0.253	0.526	0.007
Rv1746.2	16	3oht_1N1_B_1000 PDB CREDO	0.545	0.250	0.526	0.007
Rv1746.2	22	1hwi_115_C_4 PDB CREDO	0.586	0.196	0.526	0.007
Rv1746.2	16	1oq5_CEL_A_701 PDB CREDO	0.526	0.279	0.526	0.007
Rv1746.2	16	2h42_VIA_B_902 PDB CREDO	0.526	0.279	0.526	0.007
Rv1746.2	35	2xn6_T44_A_1370 PDB CREDO	0.548	0.247	0.526	0.007
Rv1746.2	35	2xpv_MIY_A_1209 PDB CREDO	0.713	0.071	0.526	0.007
Rv1746.2	8	3heg_BAX_A_1 PDB CREDO	0.614	0.163	0.525	0.007
Rv1746.2	16	3kw2_ADN_A_300 PDB CREDO	0.565	0.224	0.525	0.007
Rv1746.2	35	3jwq_VIA_B_901 PDB CREDO	0.687	0.091	0.525	0.007
Rv1746.2	35	2ydo_ADN_A_400 PDB CREDO	0.596	0.184	0.525	0.007
Rv1746.2	8	3gcs_BAX_A_401 PDB CREDO	0.632	0.143	0.525	0.007
Rv1746.2	16	3k2h_LYA_B_514 PDB CREDO	0.542	0.255	0.523	0.008
Rv1746.2	22	3ce6_ADN_A_500 PDB CREDO	0.542	0.255	0.523	0.008
Rv1746.2	8	3oct_1N1_A_663 PDB CREDO	0.598	0.182	0.522	0.008
Rv1746.2	30	1d4f_ADN_A_601 PDB CREDO	0.616	0.160	0.522	0.008
Rv1746.2	8	1err_RAL_A_600 PDB CREDO	0.574	0.211	0.522	0.008
Rv1746.2	35	3ads_IMN_B_3 PDB CREDO	0.568	0.219	0.522	0.008
Rv1746.2	6	1a4l_DCF_A_353 PDB CREDO	0.560	0.230	0.522	0.008
Rv1746.2	6	1a4l_DCF_D_1853 PDB CREDO	0.560	0.230	0.522	0.008
Rv1746.2	6	1a4l_DCF_B_853 PDB CREDO	0.560	0.231	0.521	0.008
Rv1746.2	16	2fum_MIX_D_3539 PDB CREDO	0.579	0.205	0.521	0.008
Rv1746.2	35	1mrl_DOL_A_300 PDB CREDO	0.543	0.253	0.521	0.008
Rv1746.2	6	3oct_1N1_A_663 PDB CREDO	0.521	0.286	0.521	0.008
Rv1746.2	16	3o1c_ADN_A_127 PDB CREDO	0.540	0.258	0.521	0.008
Rv1746.2	6	1a4l_DCF_C_1353 PDB CREDO	0.558	0.232	0.520	0.008
Rv1746.2	8	1err_RAL_B_600 PDB CREDO	0.572	0.214	0.520	0.008
Rv1746.2	35	3rif_IVM_E_402 PDB CREDO	0.609	0.169	0.520	0.008
Rv1746.2	16	1fm6_BRL_D_503 PDB CREDO	0.538	0.261	0.519	0.008
Rv1746.2	8	1xzx_T3_X_500 PDB CREDO	0.536	0.264	0.519	0.008
Rv1746.2	16	1s9p_DES_A_459 PDB CREDO	0.537	0.262	0.518	0.008
Rv1746.2	35	2riw_T44_A_1395 PDB CREDO	0.540	0.258	0.518	0.008
Rv1746.2	16	4eyb_0WO_B_301 PDB CREDO	0.537	0.263	0.518	0.008
Rv1746.2	35	3ri5_IVM_D_349 PDB CREDO	0.606	0.172	0.517	0.008
Rv1746.2	35	2ayl_FLP_B_2701 PDB CREDO	0.517	0.292	0.517	0.008
Rv1746.2	16	1lhu_EST_A_301 PDB CREDO	0.536	0.264	0.517	0.008
Rv1746.2	35	3rhw_IVM_B_348 PDB CREDO	0.605	0.173	0.517	0.008
Rv1746.2	35	3rhw_IVM_B_349 PDB CREDO	0.605	0.173	0.517	0.008
Rv1746.2	35	3rhw_IVM_D_348 PDB CREDO	0.605	0.173	0.517	0.008
Rv1746.2	35	3rhw_IVM_D_349 PDB CREDO	0.605	0.173	0.517	0.008
Rv1746.2	35	3ri5_IVM_B_349 PDB CREDO	0.605	0.173	0.517	0.008
Rv1746.2	35	2h42_VIA_B_902 PDB CREDO	0.676	0.100	0.516	0.009
Rv1746.2	35	1kvl_CLS_A_371 PDB CREDO	0.613	0.164	0.516	0.009
Rv1746.2	16	3jwq_VIA_D_901 PDB CREDO	0.573	0.212	0.516	0.009
Rv1746.2	35	3ria_IVM_C_350 PDB CREDO	0.605	0.174	0.516	0.009
Rv1746.2	35	3ria_IVM_E_348 PDB CREDO	0.605	0.174	0.516	0.009
Rv1746.2	8	1uwj_BAX_A_1723 PDB CREDO	0.678	0.099	0.516	0.009
Rv1746.2	8	1a4l_DCF_A_353 PDB CREDO	0.633	0.142	0.516	0.009
Rv1746.2	8	2h79_T3_A_1 PDB CREDO	0.533	0.269	0.516	0.009
Rv1746.2	8	4eyb_0WO_A_303 PDB CREDO	0.611	0.166	0.516	0.009
Rv1746.2	35	2ij7_TPF_F_2474 PDB CREDO	0.671	0.105	0.515	0.009
Rv1746.2	35	3ria_IVM_A_348 PDB CREDO	0.604	0.175	0.515	0.009
Rv1746.2	8	2jfa_RAL_B_600 PDB CREDO	0.566	0.222	0.515	0.009
Rv1746.2	6	3kw2_ADN_A_300 PDB CREDO	0.595	0.185	0.515	0.009
Rv1746.2	35	2x7h_PFN_A_1372 PDB CREDO	0.670	0.106	0.514	0.009
Rv1746.2	6	3ti1_B49_A_299 PDB CREDO	0.641	0.133	0.514	0.009
Rv1746.2	35	3rhw_IVM_A_348 PDB CREDO	0.602	0.177	0.514	0.009
Rv1746.2	35	3ri5_IVM_A_349 PDB CREDO	0.602	0.177	0.514	0.009
Rv1746.2	35	3ria_IVM_E_349 PDB CREDO	0.602	0.177	0.514	0.009
Rv1746.2	16	1cil_ETS_A_263 PDB CREDO	0.571	0.216	0.514	0.009
Rv1746.2	35	3sv8_SV6_A_1 PDB CREDO	0.513	0.299	0.513	0.009
Rv1746.2	8	1a4l_DCF_D_1853 PDB CREDO	0.629	0.146	0.512	0.009
Rv1746.2	35	2w8y_NDR_B_1000 PDB CREDO	0.555	0.237	0.512	0.009
Rv1746.2	8	1uob_PNN_A_1311 PDB CREDO	0.599	0.181	0.512	0.009
Rv1746.2	35	2itz_IRE_A_2021 PDB CREDO	0.533	0.268	0.512	0.009
Rv1746.2	6	3oht_1N1_B_1000 PDB CREDO	0.530	0.273	0.512	0.009
Rv1746.2	35	1ya3_STR_C_3001 PDB CREDO	0.646	0.128	0.512	0.009
Rv1746.2	16	2prg_BRL_A_1 PDB CREDO	0.530	0.273	0.511	0.009
Rv1746.2	35	2h42_VIA_C_903 PDB CREDO	0.669	0.106	0.511	0.009
Rv1746.2	8	2h77_T3_A_1 PDB CREDO	0.546	0.250	0.511	0.009
Rv1746.2	35	2bxg_IBP_B_2001 PDB CREDO	0.555	0.237	0.510	0.009
Rv1746.2	8	1a4l_DCF_C_1353 PDB CREDO	0.626	0.149	0.510	0.009
Rv1746.2	8	2pl0_STI_A_200 PDB CREDO	0.595	0.184	0.509	0.009
Rv1746.2	35	2xkw_P1B_B_1475 PDB CREDO	0.666	0.109	0.508	0.010
Rv1746.2	35	1fm6_BRL_D_503 PDB CREDO	0.690	0.089	0.508	0.010
Rv1746.2	35	2prg_BRL_A_1 PDB CREDO	0.690	0.089	0.508	0.010
Rv1746.2	16	3qgz_ADN_A_127 PDB CREDO	0.527	0.278	0.508	0.010
Rv1746.2	35	1m17_AQ4_A_999 PDB CREDO	0.508	0.306	0.508	0.010
Rv1746.2	35	3ik6_HCZ_B_800 PDB CREDO	0.765	0.040	0.508	0.010
Rv1746.2	6	2pgr_DCF_A_501 PDB CREDO	0.565	0.223	0.508	0.010
Rv1746.2	8	1a4l_DCF_B_853 PDB CREDO	0.623	0.153	0.507	0.010
Rv1746.2	22	2a68_RBT_M_8002 PDB CREDO	0.526	0.278	0.507	0.010
Rv1746.2	6	4eyb_0WO_A_303 PDB CREDO	0.525	0.280	0.507	0.010
Rv1746.2	35	1ie4_T44_A_128 PDB CREDO	0.507	0.308	0.507	0.010
Rv1746.2	30	3glq_RAB_A_602 PDB CREDO	0.598	0.182	0.507	0.010
Rv1746.2	16	2h77_T3_A_1 PDB CREDO	0.582	0.201	0.506	0.010
Rv1746.2	30	1v8b_ADN_B_1502 PDB CREDO	0.528	0.275	0.506	0.010
Rv1746.2	8	2hyy_STI_D_600 PDB CREDO	0.646	0.129	0.506	0.010
Rv1746.2	8	3oez_STI_A_601 PDB CREDO	0.646	0.129	0.506	0.010
Rv1746.2	16	2fum_MIX_A_539 PDB CREDO	0.505	0.310	0.505	0.010
Rv1746.2	16	2h42_VIA_C_903 PDB CREDO	0.505	0.310	0.505	0.010
Rv1746.2	16	3h52_486_C_4 PDB CREDO	0.505	0.310	0.505	0.010
Rv1746.2	6	2pgf_ADN_A_501 PDB CREDO	0.584	0.199	0.505	0.010
Rv1746.2	8	2hyy_STI_C_600 PDB CREDO	0.645	0.130	0.505	0.010
Rv1746.2	8	3pyy_STI_B_4 PDB CREDO	0.645	0.130	0.505	0.010
Rv1746.2	35	2w9s_TOP_D_1158 PDB CREDO	0.526	0.279	0.504	0.010
Rv1746.2	35	3mdz_EZL_A_264 PDB CREDO	0.549	0.246	0.504	0.010
Rv1746.2	8	3pyy_STI_A_3 PDB CREDO	0.643	0.131	0.504	0.010
Rv1746.2	8	2gqg_1N1_B_502 PDB CREDO	0.520	0.288	0.503	0.010
Rv1746.2	8	3qt0_486_A_4 PDB CREDO	0.556	0.236	0.503	0.010
Rv1746.2	35	3bbt_FMM_B_91 PDB CREDO	0.589	0.192	0.503	0.010
Rv1746.2	8	3gvu_STI_A_1001 PDB CREDO	0.642	0.132	0.503	0.010
Rv1746.2	8	3mss_STI_C_1 PDB CREDO	0.642	0.132	0.503	0.010
Rv1746.2	16	2gqg_1N1_A_501 PDB CREDO	0.503	0.314	0.503	0.010
Rv1746.2	22	4b7q_ZMR_D_601 PDB CREDO	0.521	0.286	0.502	0.011
Rv1746.2	8	1fm6_BRL_X_504 PDB CREDO	0.519	0.289	0.502	0.011
Rv1746.2	16	3ln1_CEL_D_682 PDB CREDO	0.558	0.233	0.502	0.011
Rv1746.2	16	3qt0_486_A_4 PDB CREDO	0.558	0.233	0.502	0.011
Rv1746.2	16	2uxo_TAC_B_1211 PDB CREDO	0.631	0.144	0.502	0.011
Rv1746.2	16	3sxr_1N1_A_1 PDB CREDO	0.606	0.172	0.502	0.011
Rv1746.2	8	3mss_STI_B_1 PDB CREDO	0.641	0.134	0.502	0.011
Rv1746.2	8	1zgy_BRL_A_503 PDB CREDO	0.536	0.264	0.502	0.011
Rv1746.2	16	1mx1_THA_C_3 PDB CREDO	0.519	0.288	0.501	0.011
Rv1746.2	16	1kij_NOV_A_400 PDB CREDO	0.556	0.235	0.501	0.011
Rv1746.2	35	1ll9_AXL_B_964 PDB CREDO	0.522	0.284	0.501	0.011
Rv1746.2	16	3o1x_ADN_A_1450 PDB CREDO	0.501	0.317	0.501	0.011
Rv1746.2	8	3ms9_STI_B_1 PDB CREDO	0.639	0.135	0.501	0.011
Rv1746.2	35	3jwq_VIA_D_901 PDB CREDO	0.728	0.061	0.500	0.011
Rv1746.2	8	3ln1_CEL_A_682 PDB CREDO	0.500	0.318	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

View results in TIBLE page

Name	Affinity	Assay description	DOI
CHEMBL2017707	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017708	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017709	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017710	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017711	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017712	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017713	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017714	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017715	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017716	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017717	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017718	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017719	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017720	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017721	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017722	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017723	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017724	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017725	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017726	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017727	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017728	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017729	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017730	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017731	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017732	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017733	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017734	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017735	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017736	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017737	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017738	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017739	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017870	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017871	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL549536	Active	Inhibition of Mycobacterium tuberculosis PknF	http://www.ncbi.nlm.nih.gov/pubmed/22469702

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Target name	CHEMBL ID	SMILES
Plk1(PBD)	CC(C)C1=CC(=O)C(C)=CC1=O
Plk1(PBD)	CC(C)C1=CC(=N/O)C(C)=CC1=O

STITCH interactions

No high confidence interactions