SInCRe - Rv1676

Tuberculist information

Gene name	Rv1676
Protein function	Unknown protein
Functional category(tuberculist)	conserved hypotheticals
Gene location(kb)	1901.05
Molecular mass(da)	25859.2
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 234

	  		  	1    LACPEWEISRSKRTRKPVLRPRHSVSTLTNRFLAEFCHRYGIGVPTRLARGATVPTRRLQ   60
			  	61   DINDQPVDVPAATGRTHLQFRRFAACPICHLHLRSFANRHQEVADSGITEVVFFHSAADA  120
			  	121  LRGYQSLLPFAVIADPDRVQYREFGVEKSLGAITHPRALWAAVRGSAAMLHRNDPERAGV  180
			  	181  GFGDGTTHLGLPADFLLDADGTVAAVHYGRHADDQWSVDQLIDINRSLGGKGTQ

Known structures in the PDB

No Known structures

Number of amino acids : 234

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
AhpC-TSA	PF00578	50-206

Mtb Structural Proteome models

Model Number	1
Model name	Rv1676.1
Template	2A4V APDB CREDO
Template coverage	60_212
Template Identity(%)	15.2
Model coverage(%)	63.8
Normalized DOPE score	-0.568

Model Number	2
Model name	Rv1676
Template	1TP9 APDB CREDO
Template coverage	2_122
Template Identity(%)	22.0
Model coverage(%)	46.0
Normalized DOPE score	0.276

Structure Models from Chopin

CHOPIN models not available for this query

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1676	Gene name	Confidence Score
Rv1677	dsbF	0.977

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1676.1	4	3sm2_478_A_126 PDB CREDO	0.830	0.015	0.552	0.005
Rv1676.1	4	1xkk_FMM_A_91 PDB CREDO	0.853	0.010	0.539	0.006
Rv1676.1	4	3ndt_ROC_A_101 PDB CREDO	0.527	0.277	0.517	0.008
Rv1676.1	4	3k4v_ROC_B_201 PDB CREDO	0.537	0.262	0.515	0.009
Rv1676.1	4	3oxc_ROC_A_401 PDB CREDO	0.570	0.216	0.513	0.009
Rv1676.1	4	3el4_ROC_A_100 PDB CREDO	0.670	0.105	0.503	0.010
Rv1676.1	4	1t46_STI_A_3 PDB CREDO	0.839	0.013	0.503	0.010

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions