Rv1590

Tuberculist information
Gene nameRv1590
Protein functionConserved hypothetical protein
Functional category(tuberculist)conserved hypotheticals
Gene location(kb)1791.33
Molecular mass(da)8602.83
External sites TB Database TubercuList WebTB
Protein sequence
Number of amino acids : 79
	  		  	1    MVEIVAGKQRAPVAAGVYNVYTGELADTATPTAARMGLEPPRFCAQCGRRMVVQVRPDGW   60
			  	61   WARCSRHGQVDSADLATQR

Known structures in the PDB
No Known structures
1 8 15 22 29 36 43 50 57 64 71 Range: 41 to 69  |  Coverage: 35% zf-NADH-PPase
Number of amino acids : 79
Domains assigned based on sequence. Mtb Structural proteome models CHOPIN models
Profile-based domain assignment
Structural/Functional domain familyPfam acc.no./SCOP IDDomain Region
zf-NADH-PPasePF0929741-69
Mtb Structural Proteome models
Structure models not available for this query
Structure Models from Chopin
CHOPIN models not available for this query
Binding pockets
Structure models not available for this query
STRING
Cytoscape Web will replace the contents of this div with protein-protein interaction network.
Protein interacting with Rv1590Gene nameConfidence Score
Rv1589bioB0.935
Rv1589bioB0.935
Potential ligand/drug binding sites
No binding sites identified
Similarity to known drug target from sensitive sequence analysis
No drug targets
List of small molecules tested from TIBLE
Data not available
Off-target activity - ligand based from TIBLE
Data not available
Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.
Data not available
STITCH interactions  
No high confidence interactions