Rv1567c

Tuberculist information
Gene nameRv1567c
Protein functionProbable hypothetical membrane protein
Functional category(tuberculist)cell wall and cell processes
Gene location(kb)1774.86
Molecular mass(da)10362.2
External sites TB Database TubercuList WebTB
Protein sequence
Number of amino acids : 94
	  		  	1    MVTMTSWPSRLFAFTDNVCPPDACPLVPFGVNYYIYPVMWGGIGAAIATAVIGPFVSMLK   60
			  	61   GWYMSFWPIISIAVITVTSIAGYAIAGFSERYWH

Known structures in the PDB
No Known structures
1 10 19 28 37 46 55 64 73 82 91
Number of amino acids : 94
Domains assigned based on sequence. Mtb Structural proteome models CHOPIN models
Profile-based domain assignment
Domain assignments not available for this query
Mtb Structural Proteome models
Structure models not available for this query
Structure Models from Chopin
CHOPIN models not available for this query
Binding pockets
Structure models not available for this query
STRING
Cytoscape Web will replace the contents of this div with protein-protein interaction network.
Protein interacting with Rv1567cGene nameConfidence Score
Rv1569bioF10.91
Rv1571Rv15710.909
Potential ligand/drug binding sites
No binding sites identified
Similarity to known drug target from sensitive sequence analysis
No drug targets
List of small molecules tested from TIBLE
Data not available
Off-target activity - ligand based from TIBLE
Data not available
Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.
Data not available
STITCH interactions  
No high confidence interactions