SInCRe - Rv1516c

Tuberculist information

Gene name	Rv1516c
Protein function	Probable sugar transferase
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	1707.53
Molecular mass(da)	37932.4
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 336

	  		  	1    VSPQLCPKVSIVSTTHNQAGYARQAFDSFLDQQTDFPVEIIVADDASTDATPAIIREYAE   60
			  	61   RYPHVFRPIFRTENLGLNGNLTGALSAARGEYVALCEADDYWIDPLKLSKQVAFLDRHPK  120
			  	121  TTVCFHPVRVIWEDGHAKDSKFPPVRVRGNLSLDALILMNFIQTNSAVYRRLERYDDIPA  180
			  	181  DVMPLDWYLHVRHAVHGDIAMLPDTMAVYRRHAQGMWHNQVVDPPKFWLTQGPGHAATFD  240
			  	241  AMLDLFPGDPAREELIAVMADWILRQIANVPGPEGRAALQETIARHPRIAMLALQHRGAT  300
			  	301  PARRLKTQWRKLAAATPSRRGLVDVWPSRLRRGCRA

Known structures in the PDB

No Known structures

Number of amino acids : 336

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Glycos_transf_2	PF00535	10-178

Mtb Structural Proteome models

Model Number	1
Model name	Rv1516c.1
Template	1QG8 APDB CREDO
Template coverage	2_244
Template Identity(%)	20.7
Model coverage(%)	65.8
Normalized DOPE score	-0.173

Model Number	2
Model name	Rv1516c
Template	1QG8 APDB CREDO
Template coverage	2_185
Template Identity(%)	28.2
Model coverage(%)	51.5
Normalized DOPE score	0.123

Structure Models from Chopin

Model Number	1
Profile	c.68.1.1 - 3.90.550.10 Click for model details
zscore	27.15
Residue begin	44
Residue end	274

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1516c	Gene name	Confidence Score
Rv1518	Rv1518	0.977
Rv1514c	Rv1514c	0.926

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1516c.1	1	3mss_STI_C_1 PDB CREDO	0.661	0.114	0.624	0.001
Rv1516c.1	1	3mss_STI_B_1 PDB CREDO	0.659	0.115	0.622	0.001
Rv1516c.1	1	1iep_STI_A_201 PDB CREDO	0.658	0.116	0.621	0.001
Rv1516c.1	1	1iep_STI_B_202 PDB CREDO	0.658	0.116	0.621	0.001
Rv1516c.1	1	3gvu_STI_A_1001 PDB CREDO	0.658	0.117	0.621	0.001
Rv1516c.1	1	3mss_STI_A_1 PDB CREDO	0.658	0.117	0.621	0.001
Rv1516c.1	1	3k5v_STI_B_2 PDB CREDO	0.658	0.117	0.620	0.001
Rv1516c.1	1	3mss_STI_D_1 PDB CREDO	0.658	0.117	0.620	0.001
Rv1516c.1	1	3pyy_STI_A_3 PDB CREDO	0.658	0.117	0.620	0.001
Rv1516c.1	1	3ms9_STI_A_1 PDB CREDO	0.657	0.118	0.620	0.001
Rv1516c.1	1	2hyy_STI_A_600 PDB CREDO	0.657	0.118	0.619	0.001
Rv1516c.1	1	2hyy_STI_C_600 PDB CREDO	0.657	0.118	0.619	0.001
Rv1516c.1	1	2hyy_STI_D_600 PDB CREDO	0.657	0.118	0.619	0.001
Rv1516c.1	1	3pyy_STI_B_4 PDB CREDO	0.656	0.118	0.619	0.001
Rv1516c.1	1	3ms9_STI_B_1 PDB CREDO	0.655	0.120	0.617	0.002
Rv1516c.1	1	2hyy_STI_B_600 PDB CREDO	0.631	0.144	0.612	0.002
Rv1516c.1	1	3k5v_STI_A_2 PDB CREDO	0.665	0.110	0.593	0.002
Rv1516c.1	1	1opj_STI_A_3 PDB CREDO	0.680	0.097	0.589	0.003
Rv1516c.1	1	2oiq_STI_A_1001 PDB CREDO	0.606	0.172	0.588	0.003
Rv1516c.1	1	3oez_STI_A_601 PDB CREDO	0.622	0.154	0.587	0.003
Rv1516c.1	1	1opj_STI_B_4 PDB CREDO	0.674	0.102	0.584	0.003
Rv1516c.1	1	3cs9_NIL_A_600 PDB CREDO	0.670	0.106	0.581	0.003
Rv1516c.1	1	2pl0_STI_A_200 PDB CREDO	0.592	0.189	0.575	0.003
Rv1516c.1	1	4asd_BAX_A_1500 PDB CREDO	0.571	0.216	0.571	0.004
Rv1516c.1	1	3cs9_NIL_B_600 PDB CREDO	0.676	0.101	0.570	0.004
Rv1516c.1	1	1uwj_BAX_B_1723 PDB CREDO	0.565	0.224	0.565	0.004
Rv1516c.1	1	3oez_STI_B_601 PDB CREDO	0.629	0.146	0.557	0.004
Rv1516c.1	1	3cs9_NIL_C_600 PDB CREDO	0.696	0.084	0.556	0.005
Rv1516c.1	1	3cs9_NIL_D_600 PDB CREDO	0.689	0.090	0.551	0.005
Rv1516c.1	1	3heg_BAX_A_1 PDB CREDO	0.564	0.225	0.547	0.005
Rv1516c.1	1	2jfa_RAL_B_600 PDB CREDO	0.596	0.184	0.544	0.006
Rv1516c.1	1	1uwj_BAX_A_1723 PDB CREDO	0.592	0.189	0.542	0.006
Rv1516c.1	1	3vn2_TLS_A_501 PDB CREDO	0.593	0.187	0.542	0.006
Rv1516c.1	1	3rgf_BAX_A_465 PDB CREDO	0.590	0.191	0.541	0.006
Rv1516c.1	1	1err_RAL_B_600 PDB CREDO	0.590	0.191	0.539	0.006
Rv1516c.1	1	2jfa_RAL_A_600 PDB CREDO	0.607	0.171	0.537	0.006
Rv1516c.1	1	3gcs_BAX_A_401 PDB CREDO	0.536	0.265	0.536	0.006
Rv1516c.1	1	2x9g_LYA_A_1270 PDB CREDO	0.624	0.151	0.535	0.006
Rv1516c.1	1	1err_RAL_A_600 PDB CREDO	0.585	0.197	0.534	0.006
Rv1516c.1	1	1uob_PNN_A_1311 PDB CREDO	0.550	0.244	0.534	0.006
Rv1516c.1	1	1qkn_RAL_A_600 PDB CREDO	0.643	0.132	0.533	0.007
Rv1516c.1	1	2vn1_FK5_A_501 PDB CREDO	0.611	0.166	0.529	0.007
Rv1516c.1	1	1uwh_BAX_B_1723 PDB CREDO	0.562	0.228	0.529	0.007
Rv1516c.1	1	1uwh_BAX_A_1723 PDB CREDO	0.561	0.228	0.529	0.007
Rv1516c.1	1	1y0x_T44_X_500 PDB CREDO	0.561	0.228	0.529	0.007
Rv1516c.1	1	3hec_STI_A_1 PDB CREDO	0.591	0.190	0.523	0.008
Rv1516c.1	1	1tco_FK5_C_509 PDB CREDO	0.708	0.075	0.523	0.008
Rv1516c.1	1	3b0w_DGX_B_1 PDB CREDO	0.585	0.198	0.521	0.008
Rv1516c.1	1	2gqg_1N1_B_502 PDB CREDO	0.649	0.126	0.521	0.008
Rv1516c.1	1	3nxu_RIT_A_600 PDB CREDO	0.617	0.159	0.520	0.008
Rv1516c.1	1	3nxu_RIT_B_600 PDB CREDO	0.615	0.162	0.518	0.008
Rv1516c.1	1	3b0w_DGX_A_1 PDB CREDO	0.517	0.293	0.517	0.008
Rv1516c.1	1	1fm6_BRL_X_504 PDB CREDO	0.602	0.176	0.516	0.009
Rv1516c.1	1	2w8y_486_A_1000 PDB CREDO	0.513	0.298	0.513	0.009
Rv1516c.1	1	3ln1_CEL_C_682 PDB CREDO	0.610	0.168	0.506	0.010
Rv1516c.1	1	3ln1_CEL_A_682 PDB CREDO	0.609	0.169	0.505	0.010
Rv1516c.1	1	3ln1_CEL_B_682 PDB CREDO	0.608	0.169	0.505	0.010
Rv1516c.1	1	1skx_RFP_A_1 PDB CREDO	0.593	0.187	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions