SInCRe - Rv1340

Tuberculist information

Gene name	rphA
Protein function	Probable ribonuclease RphA (RNase PH) (tRNA nucleotidyltransferase)
Functional category(tuberculist)	information pathways
Gene location(kb)	1506.76
Molecular mass(da)	27319
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 259

	  		  	1    VSKREDGRLDHELRPVIITRGFTENPAGSVLIEFGHTKVLCTASVTEGVPRWRKATGLGW   60
			  	61   LTAEYAMLPSATHSRSDRESVRGRLSGRTQEISRLIGRSLRACIDLAALGENTIAIDCDV  120
			  	121  LQADGGTRTAAITGAYVALADAVTYLSAAGKLSDPRPLSCAIAAVSVGVVDGRIRVDLPY  180
			  	181  EEDSRAEVDMNVVATDTGTLVEIQGTGEGATFARSTLDKLLDMALGACDTLFAAQRDALA  240
			  	241  LPYPGVLPQGPPPPKAFGT

Known structures in the PDB

	PDB ID	3B4T
	Total residue count	1572
	Number of chains	6
	Method	X-RAY
	Resolution	2.1

Number of amino acids : 259

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
RNase_PH	PF01138	12-144
RNase_PH_C	PF03725	160-227

Mtb Structural Proteome models

Model Number	1
Model name	Rv1340_3b4t_A
Template	3B4T APDB CREDO
Template coverage	1_247
Template Identity(%)	100.0
Model coverage(%)	95.0
Normalized DOPE score	-1.686

Model Number	2
Model name	Rv1340
Template	1R6L APDB CREDO
Template coverage	2_239
Template Identity(%)	56.6
Model coverage(%)	91.9
Normalized DOPE score	-1.134

Structure Models from Chopin

Model Number	1
Profile	3.30.230.70 Click for model details
zscore	18.34
Residue begin	1
Residue end	259

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1340	Gene name	Confidence Score
Rv1341	Rv1341	0.993
Rv1338	murI	0.984
Rv1331	Rv1331	0.921

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1340_3b4t_A	8	1r9o_FLP_A_501 PDB CREDO	0.586	0.196	0.559	0.004
Rv1340_3b4t_A	8	3hm1_J3Z_A_2 PDB CREDO	0.579	0.205	0.553	0.005
Rv1340_3b4t_A	8	2uxp_CLM_B_1211 PDB CREDO	0.566	0.222	0.540	0.006
Rv1340_3b4t_A	8	2uxp_CLM_A_1211 PDB CREDO	0.561	0.228	0.536	0.006
Rv1340_3b4t_A	8	3hbb_TMQ_A_611 PDB CREDO	0.520	0.287	0.520	0.008
Rv1340_3b4t_A	8	2bxf_DZP_A_2001 PDB CREDO	0.544	0.253	0.519	0.008
Rv1340_3b4t_A	8	2bxf_DZP_B_2001 PDB CREDO	0.543	0.254	0.518	0.008
Rv1340_3b4t_A	2	2uxp_CLM_B_1211 PDB CREDO	0.515	0.295	0.515	0.009
Rv1340_3b4t_A	8	3clb_TMQ_C_613 PDB CREDO	0.514	0.297	0.514	0.009
Rv1340_3b4t_A	2	3miy_B49_A_1 PDB CREDO	0.514	0.297	0.514	0.009
Rv1340_3b4t_A	8	1pg2_ADN_A_552 PDB CREDO	0.513	0.299	0.513	0.009
Rv1340_3b4t_A	8	2x7h_PFN_A_1372 PDB CREDO	0.512	0.300	0.512	0.009
Rv1340_3b4t_A	2	2uxp_CLM_A_1211 PDB CREDO	0.510	0.304	0.510	0.009
Rv1340_3b4t_A	2	3miy_B49_B_2 PDB CREDO	0.510	0.304	0.510	0.009
Rv1340_3b4t_A	8	2eva_ADN_A_498 PDB CREDO	0.561	0.229	0.509	0.009
Rv1340_3b4t_A	8	3s7s_EXM_A_601 PDB CREDO	0.505	0.311	0.505	0.010
Rv1340_3b4t_A	8	2uxo_TAC_B_1211 PDB CREDO	0.679	0.098	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
phosphatePubChem	0.998	96.9872
hydron diphosphatePubChem	0.979	391.981
sulfatePubChem	0.84	96.0626
hydron sulfatePubChem	0.8	196.157
adenosine diphosphatePubChem	0.761	427.201
cadmiumPubChem	0.7	232.515