SInCRe - Rv1317c

Tuberculist information

Gene name	alkA
Protein function	Probable bifunctional regulatory protein and DNA repair enzyme AlkA (regulatory protein of adaptative response) (methylphosphotriester-DNA--protein-cysteine S-methyltransferase)
Functional category(tuberculist)	information pathways
Gene location(kb)	1477.63
Molecular mass(da)	53710.5
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 496

	  		  	1    VHDDFERCYRAIQSKDARFDGWFVVAVLTTGVYCRPSCPVRPPFARNVRFLPTAAAAQGE   60
			  	61   GFRACKRCRPDASPGSPEWNVRSDVVARAMRLIADGTVDRDGVSGLAAQLGYTIRQLERL  120
			  	121  LQAVVGAGPLALARAQRMQTARVLIETTNLPFGDVAFAAGFSSIRQFNDTVRLACDGTPT  180
			  	181  ALRARAAARFESATASAGTVSLRLPVRAPFAFEGVFGHLAATAVPGCEEVRDGAYRRTLR  240
			  	241  LPWGNGIVSLTPAPDHVRCLLVLDDFRDLMTATARCRRLLDLDADPEAIVEALGADPDLR  300
			  	301  AVVGKAPGQRIPRTVDEAEFAVRAVLAQQVSTKAASTHAGRLVAAYGRPVHDRHGALTHT  360
			  	361  FPSIEQLAEIDPGHLAVPKARQRTINALVASLADKSLVLDAGCDWQRARGQLLALPGVGP  420
			  	421  WTAEVIAMRGLGDPDAFPASDLGLRLAAKKLGLPAQRRALTVHSARWRPWRSYATQHLWT  480
			  	481  TLEHPVNQWPPQEKIA

Known structures in the PDB

No Known structures

Number of amino acids : 496

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Ada_Zn_binding	PF02805	6-71
HTH_18	PF12833	106-185
AlkA_N	PF06029	201-316
HhH-GPD	PF00730	322-471

Mtb Structural Proteome models

Model Number	1
Model name	Rv1317c.2
Template	1BL0 APDB CREDO
Template coverage	12_110
Template Identity(%)	19.2
Model coverage(%)	19.8
Normalized DOPE score	-0.685

Model Number	2
Model name	Rv1317c.1
Template	1U8B APDB CREDO
Template coverage	1_138
Template Identity(%)	37.4
Model coverage(%)	27.8
Normalized DOPE score	-0.392

Model Number	3
Model name	Rv1317c
Template	1MPG APDB CREDO
Template coverage	1_274
Template Identity(%)	30.7
Model coverage(%)	56.5
Normalized DOPE score	-0.368

Structure Models from Chopin

Model Number	1
Profile	3.40.10.10 Click for model details
zscore	25.25
Residue begin	4
Residue end	73

Model Number	2
Profile	a.96.1.3 Click for model details
zscore	25.21
Residue begin	304
Residue end	489

Model Number	3
Profile	3.30.310.20 Click for model details
zscore	18.65
Residue begin	201
Residue end	316

Model Number	4
Profile	1.10.340.30 Click for model details
zscore	15.14
Residue begin	308
Residue end	434

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1317c	Gene name	Confidence Score
Rv1316c	ogt	0.991
Rv1316c	ogt	0.991

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1317c.2	1	1ya4_CTX_B_2 PDB CREDO	0.755	0.045	0.625	0.001
Rv1317c.1	2	1y0x_T44_X_500 PDB CREDO	0.701	0.080	0.622	0.001
Rv1317c.2	1	1ya4_CTX_C_3 PDB CREDO	0.750	0.048	0.621	0.001
Rv1317c.1	2	3uvv_T3_A_501 PDB CREDO	0.751	0.047	0.607	0.002
Rv1317c.1	2	2oax_SNL_D_4001 PDB CREDO	0.663	0.112	0.607	0.002
Rv1317c.1	2	2oax_SNL_F_6001 PDB CREDO	0.662	0.113	0.606	0.002
Rv1317c.1	2	2oax_SNL_E_5001 PDB CREDO	0.660	0.115	0.604	0.002
Rv1317c.1	2	2oax_SNL_A_1001 PDB CREDO	0.658	0.117	0.602	0.002
Rv1317c.1	2	1xzx_T3_X_500 PDB CREDO	0.744	0.051	0.602	0.002
Rv1317c.1	2	3kk6_CEL_B_1701 PDB CREDO	0.668	0.107	0.598	0.002
Rv1317c.1	2	2h79_T3_A_1 PDB CREDO	0.788	0.029	0.597	0.002
Rv1317c.1	2	3gws_T3_X_500 PDB CREDO	0.762	0.041	0.597	0.002
Rv1317c.1	2	3b0w_DGX_B_1 PDB CREDO	0.631	0.143	0.597	0.002
Rv1317c.2	1	3erd_DES_B_800 PDB CREDO	0.594	0.187	0.594	0.002
Rv1317c.1	2	3frq_ERY_A_195 PDB CREDO	0.610	0.168	0.592	0.002
Rv1317c.1	2	1uwj_BAX_A_1723 PDB CREDO	0.608	0.169	0.591	0.002
Rv1317c.1	2	1bsx_T3_A_1 PDB CREDO	0.755	0.045	0.591	0.002
Rv1317c.1	2	1bsx_T3_B_2 PDB CREDO	0.755	0.045	0.591	0.002
Rv1317c.1	2	3vhu_SNL_A_1001 PDB CREDO	0.706	0.076	0.590	0.003
Rv1317c.2	1	3rif_IVM_A_403 PDB CREDO	0.587	0.195	0.587	0.003
Rv1317c.1	2	3mno_DEX_A_784 PDB CREDO	0.681	0.096	0.586	0.003
Rv1317c.1	2	3bjw_SVR_E_503 PDB CREDO	0.674	0.102	0.586	0.003
Rv1317c.1	2	3mnp_DEX_A_784 PDB CREDO	0.680	0.097	0.586	0.003
Rv1317c.2	1	3bbt_FMM_D_91 PDB CREDO	0.651	0.124	0.586	0.003
Rv1317c.2	1	1mx1_THA_C_3 PDB CREDO	0.606	0.171	0.585	0.003
Rv1317c.1	2	1uob_PNN_A_1311 PDB CREDO	0.638	0.136	0.584	0.003
Rv1317c.1	2	2ab2_SNL_A_502 PDB CREDO	0.699	0.082	0.583	0.003
Rv1317c.1	2	2h77_T3_A_1 PDB CREDO	0.795	0.026	0.583	0.003
Rv1317c.1	2	2oax_SNL_C_3001 PDB CREDO	0.698	0.082	0.583	0.003
Rv1317c.1	2	2ab2_SNL_B_503 PDB CREDO	0.697	0.083	0.582	0.003
Rv1317c.1	2	2oax_SNL_B_2001 PDB CREDO	0.696	0.084	0.581	0.003
Rv1317c.1	2	3h52_486_B_1 PDB CREDO	0.624	0.152	0.571	0.004
Rv1317c.2	1	3ri5_IVM_C_350 PDB CREDO	0.570	0.217	0.570	0.004
Rv1317c.2	1	1mx1_THA_E_5 PDB CREDO	0.591	0.190	0.569	0.004
Rv1317c.2	1	3rif_IVM_B_403 PDB CREDO	0.569	0.217	0.569	0.004
Rv1317c.2	1	3rif_IVM_D_402 PDB CREDO	0.569	0.217	0.569	0.004
Rv1317c.2	1	3rif_IVM_A_402 PDB CREDO	0.569	0.218	0.569	0.004
Rv1317c.2	1	3ria_IVM_C_349 PDB CREDO	0.568	0.220	0.568	0.004
Rv1317c.1	2	3tkd_CYZ_B_267 PDB CREDO	0.638	0.137	0.566	0.004
Rv1317c.1	2	3h52_486_D_2 PDB CREDO	0.636	0.138	0.565	0.004
Rv1317c.1	2	3kk6_CEL_A_701 PDB CREDO	0.700	0.081	0.563	0.004
Rv1317c.1	2	1fm6_BRL_X_504 PDB CREDO	0.695	0.084	0.562	0.004
Rv1317c.1	2	3b0w_DGX_A_1 PDB CREDO	0.594	0.186	0.561	0.004
Rv1317c.1	3	3mdv_CL6_B_506 PDB CREDO	0.588	0.193	0.560	0.004
Rv1317c.1	2	3bjw_SVR_F_502 PDB CREDO	0.693	0.086	0.557	0.004
Rv1317c.2	5	3eor_CFV_A_901 PDB CREDO	0.695	0.084	0.557	0.004
Rv1317c.1	2	3gn8_DEX_A_247 PDB CREDO	0.711	0.073	0.557	0.004
Rv1317c.1	2	3ln1_CEL_B_682 PDB CREDO	0.711	0.073	0.557	0.004
Rv1317c.1	2	3mne_DEX_A_784 PDB CREDO	0.710	0.073	0.556	0.005
Rv1317c.1	2	3gn8_DEX_B_247 PDB CREDO	0.709	0.074	0.555	0.005
Rv1317c.1	2	3ln1_CEL_A_682 PDB CREDO	0.708	0.075	0.554	0.005
Rv1317c.1	2	3bjw_SVR_B_501 PDB CREDO	0.689	0.090	0.554	0.005
Rv1317c.1	2	3ln1_CEL_C_682 PDB CREDO	0.707	0.075	0.554	0.005
Rv1317c.1	2	3bjw_SVR_H_504 PDB CREDO	0.688	0.090	0.553	0.005
Rv1317c.1	2	2aa5_STR_A_301 PDB CREDO	0.730	0.060	0.553	0.005
Rv1317c.1	2	1m2z_DEX_A_301 PDB CREDO	0.705	0.077	0.552	0.005
Rv1317c.2	1	1jg2_ADN_A_500 PDB CREDO	0.593	0.188	0.552	0.005
Rv1317c.1	2	1sa1_POD_B_700 PDB CREDO	0.585	0.198	0.552	0.005
Rv1317c.1	2	1p93_DEX_D_4999 PDB CREDO	0.704	0.078	0.551	0.005
Rv1317c.1	2	1uwj_BAX_B_1723 PDB CREDO	0.583	0.199	0.550	0.005
Rv1317c.1	2	2aa6_STR_B_402 PDB CREDO	0.726	0.062	0.550	0.005
Rv1317c.1	2	3vn2_TLS_A_501 PDB CREDO	0.639	0.136	0.550	0.005
Rv1317c.2	1	1n49_RIT_D_401 PDB CREDO	0.862	0.008	0.550	0.005
Rv1317c.1	2	1m2z_DEX_D_401 PDB CREDO	0.702	0.079	0.549	0.005
Rv1317c.1	2	2aa5_STR_B_302 PDB CREDO	0.725	0.063	0.549	0.005
Rv1317c.1	3	3hbb_TMQ_B_612 PDB CREDO	0.577	0.208	0.549	0.005
Rv1317c.1	2	2aax_PDN_B_503 PDB CREDO	0.724	0.064	0.549	0.005
Rv1317c.1	2	1p93_DEX_C_3999 PDB CREDO	0.700	0.081	0.548	0.005
Rv1317c.1	2	2aa6_STR_A_401 PDB CREDO	0.723	0.064	0.548	0.005
Rv1317c.1	2	1hwk_117_B_1 PDB CREDO	0.548	0.247	0.548	0.005
Rv1317c.1	2	2aax_PDN_A_502 PDB CREDO	0.722	0.065	0.547	0.005
Rv1317c.1	2	3frq_ERY_B_195 PDB CREDO	0.655	0.120	0.547	0.005
Rv1317c.1	3	3tq8_TOP_A_2001 PDB CREDO	0.572	0.214	0.544	0.006
Rv1317c.2	1	3spk_TPV_A_100 PDB CREDO	0.623	0.152	0.542	0.006
Rv1317c.2	1	3so9_017_A_100 PDB CREDO	0.755	0.045	0.542	0.006
Rv1317c.1	2	1a28_STR_B_2 PDB CREDO	0.669	0.107	0.541	0.006
Rv1317c.1	2	2xkw_P1B_A_1478 PDB CREDO	0.686	0.092	0.538	0.006
Rv1317c.1	2	3h52_486_A_3 PDB CREDO	0.604	0.175	0.536	0.006
Rv1317c.1	2	3tkd_CYZ_A_266 PDB CREDO	0.642	0.132	0.536	0.006
Rv1317c.1	2	1xkk_FMM_A_91 PDB CREDO	0.667	0.109	0.536	0.006
Rv1317c.2	1	2aoh_FRD_C_305 PDB CREDO	0.769	0.038	0.536	0.006
Rv1317c.1	2	3qt0_486_A_4 PDB CREDO	0.754	0.046	0.534	0.006
Rv1317c.1	3	1dyr_TOP_A_407 PDB CREDO	0.533	0.268	0.533	0.007
Rv1317c.2	1	3bbt_FMM_B_91 PDB CREDO	0.596	0.184	0.533	0.007
Rv1317c.1	3	1qhs_CLM_A_999 PDB CREDO	0.560	0.230	0.533	0.007
Rv1317c.1	5	4dt8_ADN_A_401 PDB CREDO	0.557	0.234	0.532	0.007
Rv1317c.1	2	1zgy_BRL_A_503 PDB CREDO	0.725	0.063	0.531	0.007
Rv1317c.1	2	3ln1_CEL_D_682 PDB CREDO	0.750	0.048	0.531	0.007
Rv1317c.1	3	3fl9_TOP_A_200 PDB CREDO	0.559	0.232	0.531	0.007
Rv1317c.1	3	3fl9_TOP_G_200 PDB CREDO	0.559	0.232	0.531	0.007
Rv1317c.1	11	2w03_ADN_A_1588 PDB CREDO	0.589	0.193	0.531	0.007
Rv1317c.1	2	2hw2_RFP_A_1200 PDB CREDO	0.635	0.139	0.530	0.007
Rv1317c.2	1	3h52_486_A_3 PDB CREDO	0.738	0.054	0.530	0.007
Rv1317c.1	2	1sa1_POD_D_701 PDB CREDO	0.578	0.206	0.529	0.007
Rv1317c.2	1	3ri5_IVM_A_349 PDB CREDO	0.591	0.190	0.529	0.007
Rv1317c.2	1	3e22_LOC_B_700 PDB CREDO	0.692	0.087	0.528	0.007
Rv1317c.1	3	3rem_SAL_A_301 PDB CREDO	0.528	0.275	0.528	0.007
Rv1317c.1	3	3ay0_ADN_B_402 PDB CREDO	0.555	0.237	0.528	0.007
Rv1317c.1	2	1z2b_VLB_C_800 PDB CREDO	0.577	0.208	0.528	0.007
Rv1317c.2	1	3e22_LOC_D_700 PDB CREDO	0.690	0.088	0.527	0.007
Rv1317c.2	1	1s9p_DES_D_600 PDB CREDO	0.546	0.249	0.527	0.007
Rv1317c.1	3	3rf4_FUN_B_202 PDB CREDO	0.527	0.277	0.527	0.007
Rv1317c.1	3	3rf4_FUN_C_203 PDB CREDO	0.527	0.277	0.527	0.007
Rv1317c.2	1	3rhw_IVM_A_348 PDB CREDO	0.589	0.193	0.527	0.007
Rv1317c.1	3	3tbg_RTZ_B_1 PDB CREDO	0.609	0.168	0.526	0.007
Rv1317c.1	2	3e22_LOC_D_700 PDB CREDO	0.630	0.145	0.526	0.007
Rv1317c.1	3	3rf4_FUN_A_201 PDB CREDO	0.526	0.279	0.526	0.007
Rv1317c.1	3	3ay0_ADN_A_401 PDB CREDO	0.553	0.240	0.526	0.007
Rv1317c.2	1	3ria_IVM_E_349 PDB CREDO	0.587	0.195	0.525	0.007
Rv1317c.1	3	3n8w_FLP_A_701 PDB CREDO	0.551	0.242	0.524	0.008
Rv1317c.1	3	3fl9_TOP_B_200 PDB CREDO	0.552	0.241	0.524	0.008
Rv1317c.2	1	1jg3_ADN_A_500 PDB CREDO	0.543	0.253	0.524	0.008
Rv1317c.1	2	1ya3_STR_A_1001 PDB CREDO	0.765	0.040	0.523	0.008
Rv1317c.1	2	3e22_LOC_B_700 PDB CREDO	0.627	0.148	0.523	0.008
Rv1317c.1	11	3ilu_HFZ_B_800 PDB CREDO	0.523	0.283	0.523	0.008
Rv1317c.2	5	4dta_ADN_B_401 PDB CREDO	0.522	0.284	0.522	0.008
Rv1317c.1	3	2bdm_TMI_A_502 PDB CREDO	0.549	0.246	0.522	0.008
Rv1317c.2	5	3re0_CPT_B_201 PDB CREDO	0.559	0.231	0.522	0.008
Rv1317c.1	2	1skx_RFP_A_1 PDB CREDO	0.583	0.199	0.522	0.008
Rv1317c.1	3	3s7s_EXM_A_601 PDB CREDO	0.604	0.174	0.522	0.008
Rv1317c.2	1	1s9p_DES_A_459 PDB CREDO	0.540	0.259	0.521	0.008
Rv1317c.1	2	3jwq_VIA_D_901 PDB CREDO	0.733	0.058	0.520	0.008
Rv1317c.1	3	3ilt_TRU_E_800 PDB CREDO	0.546	0.249	0.520	0.008
Rv1317c.1	3	2w9s_TOP_C_1160 PDB CREDO	0.547	0.249	0.519	0.008
Rv1317c.1	3	3qfx_CP6_B_702 PDB CREDO	0.608	0.169	0.519	0.008
Rv1317c.1	3	3tbg_RTZ_D_1 PDB CREDO	0.573	0.213	0.519	0.008
Rv1317c.1	2	1p93_DEX_B_2999 PDB CREDO	0.732	0.058	0.519	0.008
Rv1317c.1	2	1ya3_STR_B_2001 PDB CREDO	0.758	0.043	0.519	0.008
Rv1317c.1	11	3ik6_HCZ_B_800 PDB CREDO	0.518	0.291	0.518	0.008
Rv1317c.1	2	3ut5_LOC_B_502 PDB CREDO	0.582	0.201	0.517	0.008
Rv1317c.1	3	3ik6_HCZ_B_800 PDB CREDO	0.517	0.293	0.517	0.008
Rv1317c.1	3	3jw5_TOP_A_208 PDB CREDO	0.544	0.253	0.517	0.008
Rv1317c.1	2	1lhv_NOG_A_301 PDB CREDO	0.638	0.137	0.516	0.009
Rv1317c.1	2	3d91_REM_A_350 PDB CREDO	0.547	0.248	0.516	0.009
Rv1317c.1	2	3d91_REM_B_350 PDB CREDO	0.547	0.249	0.516	0.009
Rv1317c.1	3	2bxq_IMN_A_2001 PDB CREDO	0.515	0.295	0.515	0.009
Rv1317c.1	3	3fl9_TOP_C_200 PDB CREDO	0.572	0.214	0.515	0.009
Rv1317c.1	3	3jw5_TOP_B_208 PDB CREDO	0.543	0.255	0.515	0.009
Rv1317c.1	3	3jwq_VIA_C_901 PDB CREDO	0.515	0.295	0.515	0.009
Rv1317c.1	3	3qfx_CP6_A_602 PDB CREDO	0.604	0.175	0.515	0.009
Rv1317c.1	2	2w8y_486_A_1000 PDB CREDO	0.545	0.251	0.514	0.009
Rv1317c.2	1	3erd_DES_A_600 PDB CREDO	0.514	0.296	0.514	0.009
Rv1317c.1	2	1cil_ETS_A_263 PDB CREDO	0.725	0.063	0.514	0.009
Rv1317c.1	2	1p93_DEX_A_1999 PDB CREDO	0.724	0.064	0.513	0.009
Rv1317c.1	3	2w9s_TOP_A_1160 PDB CREDO	0.540	0.258	0.513	0.009
Rv1317c.1	11	3ijx_HCZ_B_800 PDB CREDO	0.513	0.299	0.513	0.009
Rv1317c.2	1	2aoj_FRD_C_305 PDB CREDO	0.781	0.032	0.513	0.009
Rv1317c.1	2	1nhz_486_A_800 PDB CREDO	0.699	0.081	0.513	0.009
Rv1317c.1	2	3d90_NOG_A_1001 PDB CREDO	0.699	0.081	0.513	0.009
Rv1317c.2	1	1ya3_STR_A_1001 PDB CREDO	0.550	0.244	0.512	0.009
Rv1317c.1	3	2w3v_TOP_A_1169 PDB CREDO	0.565	0.223	0.512	0.009
Rv1317c.1	3	2bxf_DZP_B_2001 PDB CREDO	0.621	0.155	0.512	0.009
Rv1317c.1	2	1hwl_FBI_D_3 PDB CREDO	0.558	0.233	0.511	0.009
Rv1317c.1	3	3gvu_STI_A_1002 PDB CREDO	0.598	0.182	0.510	0.009
Rv1317c.1	3	3ijx_HCZ_B_800 PDB CREDO	0.510	0.302	0.510	0.009
Rv1317c.1	3	2eva_ADN_A_498 PDB CREDO	0.536	0.264	0.510	0.009
Rv1317c.1	2	1hwk_117_A_2 PDB CREDO	0.540	0.258	0.510	0.009
Rv1317c.1	3	3hbb_TMQ_A_611 PDB CREDO	0.590	0.191	0.509	0.009
Rv1317c.1	2	1uwh_BAX_A_1723 PDB CREDO	0.573	0.212	0.509	0.009
Rv1317c.1	2	3d90_NOG_B_2001 PDB CREDO	0.695	0.085	0.509	0.009
Rv1317c.1	3	3hgx_SAL_A_102 PDB CREDO	0.596	0.184	0.509	0.009
Rv1317c.1	3	3ik6_HCZ_B_262 PDB CREDO	0.536	0.264	0.509	0.009
Rv1317c.1	11	3rf4_FUN_A_201 PDB CREDO	0.509	0.304	0.509	0.009
Rv1317c.1	2	1hwl_FBI_B_1 PDB CREDO	0.556	0.236	0.509	0.010
Rv1317c.1	2	1uwh_BAX_B_1723 PDB CREDO	0.573	0.213	0.509	0.010
Rv1317c.1	3	2jap_J01_C_1249 PDB CREDO	0.562	0.228	0.509	0.010
Rv1317c.1	3	3vkx_T3_A_301 PDB CREDO	0.562	0.228	0.509	0.010
Rv1317c.1	2	3h0a_9RA_A_500 PDB CREDO	0.718	0.068	0.508	0.010
Rv1317c.2	1	3ri5_IVM_B_349 PDB CREDO	0.568	0.219	0.508	0.010
Rv1317c.2	1	3ri5_IVM_D_349 PDB CREDO	0.568	0.219	0.508	0.010
Rv1317c.2	1	3ria_IVM_C_350 PDB CREDO	0.568	0.219	0.508	0.010
Rv1317c.2	1	3rif_IVM_E_402 PDB CREDO	0.568	0.219	0.508	0.010
Rv1317c.1	2	1hwk_117_C_4 PDB CREDO	0.539	0.260	0.508	0.010
Rv1317c.2	1	3rhw_IVM_B_349 PDB CREDO	0.567	0.220	0.508	0.010
Rv1317c.2	1	3rhw_IVM_D_348 PDB CREDO	0.567	0.220	0.508	0.010
Rv1317c.1	3	1fdu_EST_D_352 PDB CREDO	0.508	0.306	0.508	0.010
Rv1317c.2	1	3spk_TPV_B_100 PDB CREDO	0.773	0.036	0.508	0.010
Rv1317c.1	2	2xpv_MIY_A_1209 PDB CREDO	0.768	0.039	0.507	0.010
Rv1317c.2	1	3ria_IVM_A_348 PDB CREDO	0.567	0.221	0.507	0.010
Rv1317c.2	1	3h52_486_C_4 PDB CREDO	0.506	0.308	0.506	0.010
Rv1317c.2	1	3rhw_IVM_B_348 PDB CREDO	0.566	0.222	0.506	0.010
Rv1317c.2	1	3rhw_IVM_D_349 PDB CREDO	0.566	0.222	0.506	0.010
Rv1317c.1	3	3rem_SAL_B_301 PDB CREDO	0.506	0.308	0.506	0.010
Rv1317c.1	3	3ret_SAL_A_201 PDB CREDO	0.593	0.187	0.506	0.010
Rv1317c.1	3	2jap_J01_A_1249 PDB CREDO	0.559	0.232	0.506	0.010
Rv1317c.1	3	3clb_TMQ_C_613 PDB CREDO	0.586	0.196	0.506	0.010
Rv1317c.2	1	3ria_IVM_E_348 PDB CREDO	0.565	0.224	0.505	0.010
Rv1317c.2	5	2wd9_IBP_B_1570 PDB CREDO	0.505	0.311	0.505	0.010
Rv1317c.1	3	1qhy_CLM_A_999 PDB CREDO	0.531	0.272	0.505	0.010
Rv1317c.1	3	3ua5_06X_A_501 PDB CREDO	0.531	0.272	0.505	0.010
Rv1317c.1	3	2qb4_DSM_A_801 PDB CREDO	0.504	0.312	0.504	0.010
Rv1317c.1	11	3rf4_FUN_C_203 PDB CREDO	0.504	0.312	0.504	0.010
Rv1317c.2	3	1p2y_NCT_A_440 PDB CREDO	0.503	0.313	0.503	0.010
Rv1317c.2	1	3oht_1N1_B_1000 PDB CREDO	0.521	0.285	0.503	0.010
Rv1317c.1	3	2jap_J01_B_1249 PDB CREDO	0.555	0.237	0.503	0.010
Rv1317c.1	3	3clb_TMQ_D_614 PDB CREDO	0.582	0.201	0.503	0.010
Rv1317c.1	3	1jb0_PQN_B_2002 PDB CREDO	0.503	0.314	0.503	0.010
Rv1317c.1	3	2w3a_TOP_B_1189 PDB CREDO	0.529	0.274	0.503	0.010
Rv1317c.1	3	3mg0_BO2_K_1402 PDB CREDO	0.558	0.233	0.503	0.010
Rv1317c.1	3	3mg0_BO2_Y_1403 PDB CREDO	0.558	0.233	0.503	0.010
Rv1317c.1	3	3pcq_PQN_B_842 PDB CREDO	0.503	0.314	0.503	0.010
Rv1317c.2	5	2xfh_CL6_A_1414 PDB CREDO	0.502	0.315	0.502	0.011
Rv1317c.2	5	3cfq_DIF_B_1 PDB CREDO	0.581	0.202	0.502	0.011
Rv1317c.2	5	3re0_CPT_C_201 PDB CREDO	0.502	0.315	0.502	0.011
Rv1317c.1	3	3mdv_CL6_A_506 PDB CREDO	0.609	0.168	0.502	0.011
Rv1317c.1	3	3hbb_TMQ_D_614 PDB CREDO	0.581	0.203	0.502	0.011
Rv1317c.2	1	1ya3_STR_B_2001 PDB CREDO	0.538	0.261	0.502	0.011
Rv1317c.1	2	1t46_STI_A_3 PDB CREDO	0.592	0.189	0.501	0.011
Rv1317c.1	3	1e7a_PFL_A_4001 PDB CREDO	0.556	0.235	0.501	0.011
Rv1317c.2	1	1n49_RIT_B_301 PDB CREDO	0.855	0.009	0.501	0.011
Rv1317c.1	3	2bxf_DZP_A_2001 PDB CREDO	0.608	0.170	0.501	0.011
Rv1317c.1	3	3clb_TMQ_B_612 PDB CREDO	0.608	0.170	0.501	0.011
Rv1317c.2	1	2h42_VIA_A_901 PDB CREDO	0.556	0.235	0.501	0.011
Rv1317c.2	1	3el0_1UN_A_201 PDB CREDO	0.831	0.015	0.501	0.011
Rv1317c.1	2	1hwl_FBI_A_2 PDB CREDO	0.547	0.248	0.501	0.011
Rv1317c.1	2	3ut5_LOC_D_502 PDB CREDO	0.600	0.179	0.501	0.011
Rv1317c.1	3	2jap_J01_D_1249 PDB CREDO	0.553	0.240	0.501	0.011
Rv1317c.1	2	1hwl_FBI_C_4 PDB CREDO	0.546	0.249	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions