Rv1107c

Tuberculist information
Gene namexseB
Protein functionProbable exodeoxyribonuclease VII (small subunit) XseB (exonuclease VII small subunit)
Functional category(tuberculist)information pathways
Gene location(kb)1233.97
Molecular mass(da)9322.33
External sites TB Database TubercuList WebTB
Protein sequence
Number of amino acids : 85
	  		  	1    MVCDPNGDDTGRTHATVPVSQLGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQLAK   60
			  	61   RCEEHLAGARQRVSDVLAGDEAQNG

Known structures in the PDB
No Known structures
1 9 17 25 33 41 49 57 65 73 81 Range: 24 to 76  |  Coverage: 61% Exonuc_VII_S Range: 22 to 80  |  Coverage: 68% 1
Number of amino acids : 85
Domains assigned based on sequence. Mtb Structural proteome models CHOPIN models
Profile-based domain assignment
Structural/Functional domain familyPfam acc.no./SCOP IDDomain Region
Exonuc_VII_SPF0260924-76
Mtb Structural Proteome models
Model Number1
Model nameRv1107c
Template1VP7    APDBCREDO
Template coverage18_75
Template Identity(%)41.4
Model coverage(%)68.2
Normalized DOPE score-1.214

Structure Models from Chopin
CHOPIN models not available for this query
Binding pockets
STRING
Cytoscape Web will replace the contents of this div with protein-protein interaction network.
Protein interacting with Rv1107cGene nameConfidence Score
Rv1108cxseA0.994
Rv1108cxseA0.994
Potential ligand/drug binding sites
No binding sites identified
Similarity to known drug target from sensitive sequence analysis
No drug targets
List of small molecules tested from TIBLE
Data not available
Off-target activity - ligand based from TIBLE
Data not available
Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.
Data not available
STITCH interactions  
No high confidence interactions