SInCRe - Rv0736

Tuberculist information

Gene name	rslA
Protein function	Anti-sigma factor RslA
Functional category(tuberculist)	information pathways
Gene location(kb)	828.14
Molecular mass(da)	25937.6
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 250

	  		  	1    MTMPLRGLGPPDDTGVREVSTGDDHHYAMWDAAYVLGALSAADRREFEAHLAGCPECRGA   60
			  	61   VTELCGVPALLSQLDRDEVAAISESAPTVVASGLSPELLPSLLAAVHRRRRRTRLITWVA  120
			  	121  SSAAAAVLAIGVLVGVQGHSAAPQRAAVSALPMAQVGTQLLASTVSISGEPWGTFINLRC  180
			  	181  VCLAPPYASHDTLAMVVVGRDGSQTRLATWLAEPGHTATPAGSISTPVDQIAAVQVVAAD  240
			  	241  TGQVLLQRSL

Known structures in the PDB

No Known structures

Number of amino acids : 250

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
zf-HC2	PF13490	32-59

Mtb Structural Proteome models

Model Number	1
Model name	Rv0736_3hug_B
Template	3HUG BPDB CREDO
Template coverage	25_86
Template Identity(%)	100.0
Model coverage(%)	24.4
Normalized DOPE score	-0.424

Structure Models from Chopin

CHOPIN models not available for this query

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0736	Gene name	Confidence Score
Rv0735	sigL	0.992
Rv0735	sigL	0.992

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0736_3hug_A	5	3b0w_DGX_B_1 PDB CREDO	0.696	0.084	0.658	0.001
Rv0736_3hug_A	5	1uwj_BAX_A_1723 PDB CREDO	0.676	0.100	0.622	0.001
Rv0736_3hug_A	5	3bjw_SVR_E_503 PDB CREDO	0.636	0.139	0.619	0.001
Rv0736_3hug_A	5	1t46_STI_A_3 PDB CREDO	0.642	0.133	0.608	0.002
Rv0736_3hug_A	5	1skx_RFP_A_1 PDB CREDO	0.601	0.177	0.601	0.002
Rv0736_3hug_A	5	3b0w_DGX_A_1 PDB CREDO	0.711	0.072	0.600	0.002
Rv0736_3hug_A	5	2xkw_P1B_A_1478 PDB CREDO	0.682	0.096	0.598	0.002
Rv0736_3hug_A	5	3kk6_CEL_B_1701 PDB CREDO	0.597	0.182	0.597	0.002
Rv0736_3hug_A	5	2qxs_RAL_B_600 PDB CREDO	0.596	0.184	0.596	0.002
Rv0736_3hug_A	5	2qxs_RAL_A_600 PDB CREDO	0.596	0.184	0.596	0.002
Rv0736_3hug_A	5	3cs9_NIL_B_600 PDB CREDO	0.595	0.186	0.595	0.002
Rv0736_3hug_A	5	3cs9_NIL_A_600 PDB CREDO	0.605	0.173	0.589	0.003
Rv0736_3hug_A	5	1uwj_BAX_B_1723 PDB CREDO	0.695	0.084	0.586	0.003
Rv0736_3hug_A	5	3bjw_SVR_F_502 PDB CREDO	0.652	0.123	0.586	0.003
Rv0736_3hug_A	5	3bjw_SVR_H_504 PDB CREDO	0.652	0.123	0.586	0.003
Rv0736_3hug_A	5	3bjw_SVR_B_501 PDB CREDO	0.649	0.125	0.584	0.003
Rv0736_3hug_A	5	1opj_STI_A_3 PDB CREDO	0.587	0.195	0.571	0.004
Rv0736_3hug_A	5	1xkk_FMM_A_91 PDB CREDO	0.634	0.140	0.570	0.004
Rv0736_3hug_A	5	1uwh_BAX_A_1723 PDB CREDO	0.716	0.069	0.568	0.004
Rv0736_3hug_A	5	1uwh_BAX_B_1723 PDB CREDO	0.715	0.070	0.568	0.004
Rv0736_3hug_A	5	1opj_STI_B_4 PDB CREDO	0.583	0.200	0.567	0.004
Rv0736_3hug_A	5	3cs9_NIL_D_600 PDB CREDO	0.596	0.184	0.565	0.004
Rv0736_3hug_A	5	3cs9_NIL_C_600 PDB CREDO	0.594	0.186	0.563	0.004
Rv0736_3hug_A	5	3k5v_STI_A_2 PDB CREDO	0.586	0.196	0.555	0.005
Rv0736_3hug_A	5	1y0x_T44_X_500 PDB CREDO	0.698	0.082	0.554	0.005
Rv0736_3hug_A	5	4asd_BAX_A_1500 PDB CREDO	0.655	0.119	0.553	0.005
Rv0736_3hug_A	5	3kk6_CEL_A_701 PDB CREDO	0.614	0.162	0.552	0.005
Rv0736_3hug_A	5	3nxu_RIT_A_600 PDB CREDO	0.552	0.242	0.552	0.005
Rv0736_3hug_A	5	3nxu_RIT_B_600 PDB CREDO	0.552	0.242	0.552	0.005
Rv0736_3hug_A	5	2hw2_RFP_A_1200 PDB CREDO	0.737	0.056	0.550	0.005
Rv0736_3hug_A	5	3gvu_STI_A_1001 PDB CREDO	0.612	0.164	0.548	0.005
Rv0736_3hug_A	5	3h52_486_B_1 PDB CREDO	0.669	0.107	0.548	0.005
Rv0736_3hug_A	5	3mss_STI_B_1 PDB CREDO	0.607	0.170	0.543	0.006
Rv0736_3hug_A	5	2w8y_486_A_1000 PDB CREDO	0.644	0.131	0.543	0.006
Rv0736_3hug_A	5	3pyy_STI_B_4 PDB CREDO	0.607	0.171	0.542	0.006
Rv0736_3hug_A	5	3oez_STI_A_601 PDB CREDO	0.606	0.172	0.542	0.006
Rv0736_3hug_A	5	3h52_486_D_2 PDB CREDO	0.682	0.096	0.541	0.006
Rv0736_3hug_A	5	3mss_STI_D_1 PDB CREDO	0.605	0.173	0.541	0.006
Rv0736_3hug_A	5	2hyy_STI_C_600 PDB CREDO	0.605	0.173	0.541	0.006
Rv0736_3hug_A	5	1fm6_BRL_X_504 PDB CREDO	0.748	0.049	0.541	0.006
Rv0736_3hug_A	5	3k5v_STI_B_2 PDB CREDO	0.605	0.174	0.541	0.006
Rv0736_3hug_A	5	2hyy_STI_D_600 PDB CREDO	0.604	0.174	0.540	0.006
Rv0736_3hug_A	5	2hyy_STI_A_600 PDB CREDO	0.604	0.175	0.540	0.006
Rv0736_3hug_A	5	3frq_ERY_A_195 PDB CREDO	0.621	0.155	0.539	0.006
Rv0736_3hug_A	5	3mss_STI_A_1 PDB CREDO	0.603	0.176	0.539	0.006
Rv0736_3hug_A	5	3mss_STI_C_1 PDB CREDO	0.602	0.177	0.538	0.006
Rv0736_3hug_A	5	1iep_STI_B_202 PDB CREDO	0.601	0.177	0.538	0.006
Rv0736_3hug_A	5	3ms9_STI_B_1 PDB CREDO	0.600	0.178	0.537	0.006
Rv0736_3hug_A	5	3pyy_STI_A_3 PDB CREDO	0.600	0.178	0.537	0.006
Rv0736_3hug_A	5	3heg_BAX_A_1 PDB CREDO	0.655	0.120	0.536	0.006
Rv0736_3hug_A	5	2oiq_STI_A_1001 PDB CREDO	0.654	0.120	0.536	0.006
Rv0736_3hug_A	5	1xzx_T3_X_500 PDB CREDO	0.740	0.053	0.535	0.006
Rv0736_3hug_A	5	1iep_STI_A_201 PDB CREDO	0.598	0.181	0.535	0.006
Rv0736_3hug_A	5	3ms9_STI_A_1 PDB CREDO	0.598	0.182	0.534	0.006
Rv0736_3hug_A	5	3uvv_T3_A_501 PDB CREDO	0.736	0.056	0.532	0.007
Rv0736_3hug_A	5	3gp0_NIL_A_1 PDB CREDO	0.575	0.210	0.531	0.007
Rv0736_3hug_A	5	1z2b_VLB_C_800 PDB CREDO	0.645	0.130	0.528	0.007
Rv0736_3hug_A	5	3vn2_TLS_A_501 PDB CREDO	0.684	0.094	0.526	0.007
Rv0736_3hug_A	5	3gws_T3_X_500 PDB CREDO	0.751	0.047	0.526	0.007
Rv0736_3hug_A	5	3h52_486_A_3 PDB CREDO	0.660	0.115	0.524	0.008
Rv0736_3hug_A	5	1bsx_T3_A_1 PDB CREDO	0.745	0.051	0.521	0.008
Rv0736_3hug_A	5	1bsx_T3_B_2 PDB CREDO	0.745	0.051	0.521	0.008
Rv0736_3hug_A	5	2hyy_STI_B_600 PDB CREDO	0.636	0.139	0.521	0.008
Rv0736_3hug_A	5	3bjw_SVR_G_506 PDB CREDO	0.549	0.246	0.520	0.008
Rv0736_3hug_A	5	1ya4_CTX_A_1 PDB CREDO	0.654	0.121	0.519	0.008
Rv0736_3hug_A	5	3gcs_BAX_A_401 PDB CREDO	0.614	0.162	0.518	0.008
Rv0736_3hug_A	5	3sm2_478_A_126 PDB CREDO	0.605	0.174	0.517	0.008
Rv0736_3hug_A	5	2oax_SNL_D_4001 PDB CREDO	0.630	0.145	0.515	0.009
Rv0736_3hug_A	5	3d91_REM_B_350 PDB CREDO	0.610	0.167	0.515	0.009
Rv0736_3hug_A	5	2oax_SNL_E_5001 PDB CREDO	0.627	0.148	0.513	0.009
Rv0736_3hug_A	5	1a28_STR_B_2 PDB CREDO	0.709	0.074	0.512	0.009
Rv0736_3hug_A	5	2oax_SNL_F_6001 PDB CREDO	0.626	0.149	0.512	0.009
Rv0736_3hug_A	5	3bjw_SVR_C_505 PDB CREDO	0.525	0.280	0.511	0.009
Rv0736_3hug_A	5	2v0z_C41_O_1327 PDB CREDO	0.553	0.239	0.511	0.009
Rv0736_3hug_A	5	3d91_REM_A_350 PDB CREDO	0.606	0.172	0.511	0.009
Rv0736_3hug_A	5	3frq_ERY_B_195 PDB CREDO	0.683	0.094	0.510	0.009
Rv0736_3hug_A	5	2oax_SNL_A_1001 PDB CREDO	0.622	0.154	0.509	0.009
Rv0736_3hug_A	5	2pl0_STI_A_200 PDB CREDO	0.621	0.155	0.508	0.010
Rv0736_3hug_A	5	3mnp_DEX_A_784 PDB CREDO	0.659	0.116	0.507	0.010
Rv0736_3hug_A	5	3mno_DEX_A_784 PDB CREDO	0.654	0.121	0.504	0.010
Rv0736_3hug_A	5	1zgy_BRL_A_503 PDB CREDO	0.768	0.038	0.503	0.010
Rv0736_3hug_A	5	2jfa_RAL_B_600 PDB CREDO	0.652	0.123	0.502	0.011
Rv0736_3hug_A	5	1err_RAL_A_600 PDB CREDO	0.650	0.124	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
hydron sulfatePubChem	0.9	196.157
zincPubChem	0.9	65.409
sulfatePubChem	0.9	96.0626