SInCRe - Rv0447c

Tuberculist information

Gene name	ufaA1
Protein function	Probable cyclopropane-fatty-acyl-phospholipid synthase UfaA1 (cyclopropane fatty acid synthase) (CFA synthase)
Functional category(tuberculist)	lipid metabolism
Gene location(kb)	535.224
Molecular mass(da)	47767.5
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 427

	  		  	1    MTVETSQTPSAAIDSDRWPAVAKVPRGPLAAASAAIANRLLRRTATHLPLRLVYSDGTAT   60
			  	61   GAADPRAPSLFIHRPDALARRIGRHGLIGFGESYMAGEWSSKELTRVLTVLAGSVDELVP  120
			  	121  RSLHWLRPITPTFRPSWPDHSRDQARRNIAVHYDLSNDLFAAFLDETMTYSCAMFTDLLA  180
			  	181  QPTPAWTELAAAQRRKIDRLLDVAGVQQGSHVLEIGTGWGELCIRAAARGAHIRSVTLSV  240
			  	241  EQQRLARQRVAAAGFGHRVEIDLCDYRDVDGQYDSVVSVEMIEAVGYRSWPRYFAALEQL  300
			  	301  VRPGGPVAIQAITMPHHRMLATRHTQTWIQKYIFPGGLLPSTQAIIDITGQHTGLRIVDA  360
			  	361  ASLRPHYAETLRLWRERFMQRRDGLAHLGFDEVFARMWELYLAYSEAGFRSGYLDVYQWT  420
			  	421  LIREGPP

Known structures in the PDB

No Known structures

Number of amino acids : 427

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
CMAS	PF02353	140-419

Mtb Structural Proteome models

Model Number	1
Model name	Rv0447c
Template	2FK8 APDB CREDO
Template coverage	21_298
Template Identity(%)	32.1
Model coverage(%)	64.6
Normalized DOPE score	-0.682

Model Number	2
Model name	Rv0447c.1
Template	1UWV APDB CREDO
Template coverage	74_423
Template Identity(%)	11.1
Model coverage(%)	79.6
Normalized DOPE score	0.754

Structure Models from Chopin

Model Number	1
Profile	c.66.1.18 - 3.40.50.150 Click for model details
zscore	47.87
Residue begin	139
Residue end	427

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0447c	Gene name	Confidence Score
Rv0448c	Rv0448c	0.995
Rv0449c	Rv0449c	0.993
Rv0446c	Rv0446c	0.986

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0447c.1	6	3bbt_FMM_B_91 PDB CREDO	0.640	0.134	0.640	0.001
Rv0447c.1	6	3cs8_BRL_A_503 PDB CREDO	0.673	0.103	0.623	0.001
Rv0447c.1	6	1fm6_BRL_D_503 PDB CREDO	0.702	0.079	0.606	0.002
Rv0447c.1	6	1s9p_DES_A_459 PDB CREDO	0.693	0.086	0.598	0.002
Rv0447c.1	6	2prg_BRL_A_1 PDB CREDO	0.689	0.090	0.595	0.002
Rv0447c.1	6	1g50_EST_A_600 PDB CREDO	0.666	0.109	0.592	0.002
Rv0447c.1	3	3sm2_478_A_126 PDB CREDO	0.699	0.081	0.591	0.002
Rv0447c.1	6	1ya4_CTX_B_2 PDB CREDO	0.638	0.136	0.591	0.002
Rv0447c.1	6	3ols_EST_A_600 PDB CREDO	0.663	0.112	0.589	0.003
Rv0447c.1	6	3ols_EST_B_600 PDB CREDO	0.663	0.112	0.589	0.003
Rv0447c.1	6	2h77_T3_A_1 PDB CREDO	0.756	0.044	0.589	0.003
Rv0447c.1	3	1xkk_FMM_A_91 PDB CREDO	0.732	0.059	0.588	0.003
Rv0447c.1	6	2xkw_P1B_B_1475 PDB CREDO	0.655	0.120	0.586	0.003
Rv0447c.1	6	3uud_EST_A_600 PDB CREDO	0.659	0.116	0.586	0.003
Rv0447c.1	6	3uud_EST_B_600 PDB CREDO	0.659	0.116	0.586	0.003
Rv0447c.1	6	3h0a_9RA_A_500 PDB CREDO	0.727	0.061	0.586	0.003
Rv0447c.1	6	2w8y_NDR_B_1000 PDB CREDO	0.632	0.143	0.585	0.003
Rv0447c.1	6	1zgy_BRL_A_503 PDB CREDO	0.750	0.048	0.584	0.003
Rv0447c.1	6	3oht_1N1_A_1000 PDB CREDO	0.606	0.172	0.584	0.003
Rv0447c.1	6	1s9p_DES_B_459 PDB CREDO	0.630	0.145	0.583	0.003
Rv0447c.1	6	1ya3_STR_C_3001 PDB CREDO	0.628	0.147	0.582	0.003
Rv0447c.1	6	1s9p_DES_C_500 PDB CREDO	0.628	0.147	0.581	0.003
Rv0447c.1	6	1ya4_CTX_C_3 PDB CREDO	0.628	0.147	0.581	0.003
Rv0447c.1	6	3h52_486_C_4 PDB CREDO	0.649	0.126	0.581	0.003
Rv0447c.1	6	3gws_T3_X_500 PDB CREDO	0.795	0.027	0.579	0.003
Rv0447c.1	6	1bsx_T3_A_1 PDB CREDO	0.794	0.027	0.579	0.003
Rv0447c.1	6	1bsx_T3_B_2 PDB CREDO	0.794	0.027	0.579	0.003
Rv0447c.1	6	2yja_EST_B_1550 PDB CREDO	0.651	0.124	0.578	0.003
Rv0447c.1	6	3adx_IMN_B_3 PDB CREDO	0.650	0.125	0.578	0.003
Rv0447c.1	6	2h79_T3_A_1 PDB CREDO	0.767	0.039	0.578	0.003
Rv0447c.1	6	1gs4_ZK5_A_1918 PDB CREDO	0.644	0.131	0.576	0.003
Rv0447c.1	3	1t46_STI_A_3 PDB CREDO	0.752	0.047	0.573	0.003
Rv0447c.1	6	3erd_DES_A_600 PDB CREDO	0.639	0.135	0.572	0.003
Rv0447c.1	6	3erd_DES_B_800 PDB CREDO	0.637	0.137	0.570	0.004
Rv0447c.1	6	3jwq_VIA_B_901 PDB CREDO	0.635	0.140	0.568	0.004
Rv0447c.1	6	2cbr_A80_A_201 PDB CREDO	0.589	0.192	0.567	0.004
Rv0447c.1	6	2h42_VIA_C_903 PDB CREDO	0.634	0.141	0.567	0.004
Rv0447c.1	6	1xzx_T3_X_500 PDB CREDO	0.803	0.024	0.566	0.004
Rv0447c.1	6	3jwq_VIA_D_901 PDB CREDO	0.702	0.079	0.565	0.004
Rv0447c.1	6	3ln1_CEL_D_682 PDB CREDO	0.701	0.080	0.565	0.004
Rv0447c.1	6	2prg_BRL_B_2 PDB CREDO	0.653	0.121	0.564	0.004
Rv0447c.1	6	1ya3_STR_A_1001 PDB CREDO	0.676	0.100	0.564	0.004
Rv0447c.1	6	1sqn_NDR_A_1001 PDB CREDO	0.651	0.124	0.562	0.004
Rv0447c.1	6	1mx1_THA_F_6 PDB CREDO	0.606	0.172	0.561	0.004
Rv0447c.1	6	1sqn_NDR_B_2001 PDB CREDO	0.648	0.126	0.560	0.004
Rv0447c.1	6	2uxo_TAC_B_1211 PDB CREDO	0.629	0.146	0.559	0.004
Rv0447c.1	6	3sxr_1N1_A_1 PDB CREDO	0.604	0.174	0.559	0.004
Rv0447c.1	6	3uvv_T3_A_501 PDB CREDO	0.790	0.029	0.558	0.004
Rv0447c.1	6	1s9p_DES_D_600 PDB CREDO	0.644	0.131	0.556	0.005
Rv0447c.1	6	3oht_1N1_B_1000 PDB CREDO	0.643	0.131	0.555	0.005
Rv0447c.1	6	1mx1_THA_D_4 PDB CREDO	0.599	0.180	0.554	0.005
Rv0447c.1	3	1c6z_ROC_B_505 PDB CREDO	0.640	0.134	0.554	0.005
Rv0447c.1	3	3prs_RIT_A_1001 PDB CREDO	0.624	0.151	0.554	0.005
Rv0447c.1	6	3bbt_FMM_D_91 PDB CREDO	0.686	0.092	0.552	0.005
Rv0447c.1	6	1mx1_THA_E_5 PDB CREDO	0.595	0.185	0.552	0.005
Rv0447c.1	6	2q1v_PDN_A_248 PDB CREDO	0.661	0.114	0.551	0.005
Rv0447c.1	6	3ads_IMN_B_3 PDB CREDO	0.702	0.079	0.551	0.005
Rv0447c.1	3	3el4_ROC_A_100 PDB CREDO	0.577	0.208	0.550	0.005
Rv0447c.1	6	1ya3_STR_B_2001 PDB CREDO	0.660	0.115	0.550	0.005
Rv0447c.1	6	3qt0_486_A_4 PDB CREDO	0.681	0.096	0.549	0.005
Rv0447c.1	6	1mx1_THA_C_3 PDB CREDO	0.633	0.142	0.546	0.005
Rv0447c.1	3	2v0z_C41_C_1328 PDB CREDO	0.641	0.134	0.541	0.006
Rv0447c.1	6	3sxr_1N1_B_2 PDB CREDO	0.608	0.169	0.541	0.006
Rv0447c.1	6	2h42_VIA_A_901 PDB CREDO	0.668	0.107	0.538	0.006
Rv0447c.1	6	1a28_STR_A_1 PDB CREDO	0.623	0.152	0.538	0.006
Rv0447c.1	3	2v0z_C41_O_1327 PDB CREDO	0.685	0.092	0.536	0.006
Rv0447c.1	6	3qlg_1N1_A_601 PDB CREDO	0.557	0.235	0.536	0.006
Rv0447c.1	6	3qlg_1N1_B_601 PDB CREDO	0.556	0.236	0.535	0.006
Rv0447c.1	6	2ito_IRE_A_2020 PDB CREDO	0.534	0.267	0.534	0.006
Rv0447c.1	6	3g5d_1N1_A_1 PDB CREDO	0.554	0.238	0.533	0.007
Rv0447c.1	3	2q64_1UN_B_1001 PDB CREDO	0.615	0.162	0.532	0.007
Rv0447c.1	6	1z9y_FUN_A_500 PDB CREDO	0.532	0.270	0.532	0.007
Rv0447c.1	6	3aod_RFP_C_2002 PDB CREDO	0.573	0.213	0.531	0.007
Rv0447c.1	6	2j7y_E3O_A_1454 PDB CREDO	0.530	0.272	0.530	0.007
Rv0447c.1	6	1fm6_BRL_X_504 PDB CREDO	0.751	0.047	0.530	0.007
Rv0447c.1	6	2zva_1N1_A_513 PDB CREDO	0.573	0.213	0.530	0.007
Rv0447c.1	6	3g5d_1N1_B_1 PDB CREDO	0.551	0.243	0.530	0.007
Rv0447c.1	6	3q1e_T44_C_128 PDB CREDO	0.530	0.273	0.530	0.007
Rv0447c.1	6	2xn5_FUN_A_1356 PDB CREDO	0.595	0.185	0.529	0.007
Rv0447c.1	3	2xkw_P1B_A_1478 PDB CREDO	0.642	0.133	0.528	0.007
Rv0447c.1	3	2pyn_1UN_A_1001 PDB CREDO	0.610	0.167	0.528	0.007
Rv0447c.1	3	2q63_1UN_A_1001 PDB CREDO	0.610	0.167	0.528	0.007
Rv0447c.1	3	2qak_1UN_A_1001 PDB CREDO	0.609	0.168	0.528	0.007
Rv0447c.1	6	1xp0_VDN_A_201 PDB CREDO	0.672	0.104	0.527	0.007
Rv0447c.1	6	1nhz_486_A_800 PDB CREDO	0.676	0.100	0.527	0.007
Rv0447c.1	6	1jg3_ADN_A_500 PDB CREDO	0.567	0.221	0.526	0.007
Rv0447c.1	3	2pym_1UN_A_1001 PDB CREDO	0.607	0.171	0.526	0.007
Rv0447c.1	6	1ie4_T44_B_328 PDB CREDO	0.544	0.252	0.524	0.008
Rv0447c.1	6	3oct_1N1_A_663 PDB CREDO	0.627	0.148	0.523	0.008
Rv0447c.1	6	1jg3_ADN_B_550 PDB CREDO	0.541	0.256	0.521	0.008
Rv0447c.1	6	3lfa_1N1_A_361 PDB CREDO	0.637	0.138	0.521	0.008
Rv0447c.1	6	3kw2_ADN_B_300 PDB CREDO	0.562	0.228	0.520	0.008
Rv0447c.1	6	3o1c_ADN_A_127 PDB CREDO	0.560	0.231	0.519	0.008
Rv0447c.1	6	3r9c_ECL_A_452 PDB CREDO	0.634	0.141	0.519	0.008
Rv0447c.1	6	3k54_1N1_A_1 PDB CREDO	0.559	0.232	0.519	0.008
Rv0447c.1	3	1k6c_MK1_B_902 PDB CREDO	0.543	0.254	0.518	0.008
Rv0447c.1	3	3bjw_SVR_H_504 PDB CREDO	0.646	0.129	0.518	0.008
Rv0447c.1	6	1y0x_T44_X_500 PDB CREDO	0.806	0.022	0.518	0.008
Rv0447c.1	3	1t7i_017_A_200 PDB CREDO	0.541	0.256	0.517	0.008
Rv0447c.1	3	3bjw_SVR_B_501 PDB CREDO	0.644	0.131	0.517	0.008
Rv0447c.1	6	3ln1_CEL_C_682 PDB CREDO	0.707	0.076	0.515	0.009
Rv0447c.1	6	3ln1_CEL_A_682 PDB CREDO	0.705	0.077	0.514	0.009
Rv0447c.1	6	3ln1_CEL_B_682 PDB CREDO	0.705	0.077	0.514	0.009
Rv0447c.1	6	2xpv_MIY_A_1209 PDB CREDO	0.595	0.185	0.514	0.009
Rv0447c.1	3	3bjw_SVR_F_502 PDB CREDO	0.640	0.135	0.513	0.009
Rv0447c.1	3	3k4v_ROC_D_201 PDB CREDO	0.526	0.279	0.513	0.009
Rv0447c.1	3	1uwj_BAX_A_1723 PDB CREDO	0.773	0.036	0.513	0.009
Rv0447c.1	3	3bjw_SVR_E_503 PDB CREDO	0.691	0.088	0.512	0.009
Rv0447c.1	6	1p93_DEX_A_1999 PDB CREDO	0.636	0.139	0.512	0.009
Rv0447c.1	6	1ie4_T44_A_128 PDB CREDO	0.599	0.180	0.512	0.009
Rv0447c.1	6	2aa6_STR_A_401 PDB CREDO	0.679	0.098	0.511	0.009
Rv0447c.1	3	3gp0_NIL_A_1 PDB CREDO	0.654	0.121	0.511	0.009
Rv0447c.1	6	3spk_TPV_A_100 PDB CREDO	0.655	0.120	0.510	0.009
Rv0447c.1	6	1mx1_THA_A_1 PDB CREDO	0.622	0.153	0.509	0.009
Rv0447c.1	6	2aax_PDN_B_503 PDB CREDO	0.676	0.100	0.509	0.009
Rv0447c.1	6	3qgz_ADN_A_127 PDB CREDO	0.549	0.246	0.509	0.009
Rv0447c.1	6	1jg2_ADN_A_500 PDB CREDO	0.610	0.167	0.509	0.010
Rv0447c.1	6	2aa6_STR_B_402 PDB CREDO	0.676	0.101	0.509	0.010
Rv0447c.1	6	3f4x_KLT_A_300 PDB CREDO	0.509	0.305	0.509	0.010
Rv0447c.1	6	3ri5_IVM_A_349 PDB CREDO	0.509	0.305	0.509	0.010
Rv0447c.1	6	3ria_IVM_E_349 PDB CREDO	0.509	0.305	0.509	0.010
Rv0447c.1	6	2h42_VIA_B_902 PDB CREDO	0.568	0.219	0.508	0.010
Rv0447c.1	6	3rhw_IVM_A_348 PDB CREDO	0.508	0.306	0.508	0.010
Rv0447c.1	6	3rif_IVM_E_402 PDB CREDO	0.508	0.306	0.508	0.010
Rv0447c.1	6	2aax_PDN_A_502 PDB CREDO	0.674	0.102	0.508	0.010
Rv0447c.1	3	2nnk_ROC_A_401 PDB CREDO	0.544	0.252	0.507	0.010
Rv0447c.1	6	1p93_DEX_B_2999 PDB CREDO	0.630	0.145	0.507	0.010
Rv0447c.1	6	3oll_EST_A_600 PDB CREDO	0.647	0.128	0.507	0.010
Rv0447c.1	6	3ria_IVM_E_348 PDB CREDO	0.507	0.307	0.507	0.010
Rv0447c.1	3	3ndt_ROC_D_100 PDB CREDO	0.544	0.253	0.507	0.010
Rv0447c.1	6	3ria_IVM_A_348 PDB CREDO	0.507	0.308	0.507	0.010
Rv0447c.1	6	3adx_IMN_A_2 PDB CREDO	0.565	0.223	0.506	0.010
Rv0447c.1	6	1a27_EST_A_350 PDB CREDO	0.526	0.279	0.506	0.010
Rv0447c.1	6	3b2r_VDN_A_1 PDB CREDO	0.704	0.078	0.506	0.010
Rv0447c.1	6	3oll_EST_B_600 PDB CREDO	0.645	0.130	0.506	0.010
Rv0447c.1	6	3rhw_IVM_B_348 PDB CREDO	0.506	0.309	0.506	0.010
Rv0447c.1	6	3rhw_IVM_D_349 PDB CREDO	0.506	0.309	0.506	0.010
Rv0447c.1	6	2o7o_DXT_A_222 PDB CREDO	0.568	0.219	0.505	0.010
Rv0447c.1	6	2vke_TAC_A_222 PDB CREDO	0.525	0.280	0.505	0.010
Rv0447c.1	6	3ri5_IVM_D_349 PDB CREDO	0.505	0.310	0.505	0.010
Rv0447c.1	6	3b2r_VDN_B_1 PDB CREDO	0.702	0.079	0.504	0.010
Rv0447c.1	6	3rhw_IVM_D_348 PDB CREDO	0.504	0.312	0.504	0.010
Rv0447c.1	6	3ri5_IVM_B_349 PDB CREDO	0.504	0.312	0.504	0.010
Rv0447c.1	6	3rhw_IVM_B_349 PDB CREDO	0.504	0.313	0.504	0.010
Rv0447c.1	6	3e22_LOC_B_700 PDB CREDO	0.736	0.056	0.503	0.010
Rv0447c.1	6	2trt_TAC_A_222 PDB CREDO	0.566	0.222	0.503	0.010
Rv0447c.1	6	3ads_IMN_A_2 PDB CREDO	0.603	0.175	0.503	0.010
Rv0447c.1	3	3frq_ERY_A_195 PDB CREDO	0.801	0.024	0.503	0.010
Rv0447c.1	6	3e22_LOC_D_700 PDB CREDO	0.735	0.057	0.502	0.011
Rv0447c.1	6	2ayl_FLP_B_2701 PDB CREDO	0.588	0.193	0.502	0.011
Rv0447c.1	6	3ria_IVM_C_350 PDB CREDO	0.502	0.315	0.502	0.011
Rv0447c.1	3	3pww_ROC_A_1001 PDB CREDO	0.659	0.116	0.502	0.011
Rv0447c.1	6	1g50_EST_C_2600 PDB CREDO	0.639	0.135	0.501	0.011
Rv0447c.1	6	2xpw_OTC_A_222 PDB CREDO	0.521	0.286	0.501	0.011
Rv0447c.1	3	3ndu_ROC_D_100 PDB CREDO	0.513	0.299	0.501	0.011
Rv0447c.1	6	2ayl_FLP_A_1701 PDB CREDO	0.520	0.287	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
S-adenosyl-methioninePubChem	0.9	398.437
S-adenosyl-L-methioninePubChem	0.9	399.445
S-adenosylhomocysteinePubChem	0.9	384.411